KEGG   Helobdella robusta: HELRODRAFT_141265Help
Entry
HELRODRAFT_141265 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K15276  solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2
Organism
hro  Helobdella robusta
Brite
KEGG Orthology (KO) [BR:hro00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hro02000]
    HELRODRAFT_141265
Transporters [BR:hro02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   HELRODRAFT_141265
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UAA EamA CRT-like
Motif
Other DBs
NCBI-GeneID: 20196582
NCBI-ProteinID: XP_009028016
JGI: Helro1_141265
UniProt: T1EJ32
LinkDB All DBs
Position
Unknown
AA seq 401 aa AA seqDB search
WQDIWWYRLLTNLFNYSTIIIPCFLLVFVIKRTKYLERAGRFFNNLLLKLFIDGRELSSF
EEINMKKPAYNTSQNSSATLSLFSFENKFVATTVKLCFYSCGLLLSYLIWGIVQERVMVY
EYKDNTTGRQKGERFTNSQFIVFANRVLAFVVAVVGIRMLEQPCHRAPFYKYIYCSFSNI
MSSWCQYEALKFVSFPVQVLAKTIKVIPVMLMGRVISRRSYSVFEYITASMISAGVFIFL
ITSEDGPGSKSSDSTHTSISGVVILIGYLMFDSFTSNWQDDLFNKFKVTSLQMMAGVNFF
SVLLTWVSLMEQGTFTEALSFASRHPSFTLHILILSITSAIGQLFIFATIANFGPATFTI
VMTIRQGLAILLSCIIYGHQVRLSGGIGVAIVFASLFIRVY
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
tggcaggatatttggtggtacagactgctgacaaatcttttcaattattccactattatt
attccttgctttcttttggtttttgtgataaagaggactaagtacttggaaagagctggt
agattttttaataatttgttgttgaagttgttcatagatggcagggagttgtcatcattt
gaagagattaatatgaagaaaccagcatacaacacgtcacaaaactcatcggcaacttta
tcacttttctcgtttgaaaacaaatttgtggccacaacggtcaagttatgtttctacagt
tgcggcctgctgctttcttatttgatatggggcatagtgcaagagagagtcatggtgtat
gaatataaggacaacacgactgggagacagaagggtgaacgattcaccaactcacagttc
atcgtgtttgccaatcgggtgcttgcgttcgtggtagctgttgtaggaattcgcatgttg
gagcagccctgccatagagctcctttctacaagtacatctactgttcattctccaacatc
atgagcagttggtgccaatatgaagcactcaagtttgtcagcttccctgttcaggtgtta
gcaaaaacgataaaagtcattccagtgatgctgatgggcagggtaatttccaggaggtcc
tattccgtctttgagtacatcactgcttccatgatatctgccggggtcttcatcttccta
attaccagcgaagacggacctggttctaagtcatcggacagcacccacaccagcatctct
ggggtcgtcatcctcatcggctacctcatgtttgattcgttcacgtccaactggcaagat
gacctcttcaataagttcaaggtgacgtcactgcagatgatggcaggtgtcaactttttc
tctgtcttgcttacttgggtgtcactgatggagcaagggacattcacggaggcgttaagc
ttcgcctcgcgtcatccatccttcactcttcatattctcattctctcaatcacctctgcc
attggtcagttgttcatcttcgccaccatcgccaatttcgggccggccactttcaccatc
gtcatgactattaggcagggtttggctattttgctgtcgtgcataatttatggacatcag
gttcgtttgtctggtggcataggagtagccattgtatttgcctcgctcttcatcagagtc
tac

DBGET integrated database retrieval system