KEGG   Helobdella robusta: HELRODRAFT_151946Help
Entry
HELRODRAFT_151946 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
hro  Helobdella robusta
Pathway
hro00562  Inositol phosphate metabolism
hro01100  Metabolic pathways
hro04068  FoxO signaling pathway
hro04070  Phosphatidylinositol signaling system
hro04140  Autophagy - animal
hro04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    HELRODRAFT_151946
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    HELRODRAFT_151946
   04070 Phosphatidylinositol signaling system
    HELRODRAFT_151946
   04150 mTOR signaling pathway
    HELRODRAFT_151946
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    HELRODRAFT_151946
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hro01009]
    HELRODRAFT_151946
Enzymes [BR:hro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     HELRODRAFT_151946
    3.1.3.48  protein-tyrosine-phosphatase
     HELRODRAFT_151946
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     HELRODRAFT_151946
Protein phosphatases and associated proteins [BR:hro01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    HELRODRAFT_151946
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc PTPlike_phytase Y_phosphatase Y_phosphatase3 DSPn
Motif
Other DBs
NCBI-GeneID: 20197131
NCBI-ProteinID: XP_009031594
JGI: Helro1_151946
UniProt: T1EKN1
LinkDB All DBs
Position
Unknown
AA seq 171 aa AA seqDB search
MPNKLKELVSKNKIRYQEDGFDLDLAYITNNIIAMGFPAENLEGVYRNHLDDVHRLLELK
HGNHYRIYNLCQEKEYAKSKFKGYVIRYPFEDHNPPTLELMRNFCEDVKKWHDEDLKNVA
VIHCKAGKGRTGVMICAYLVYINKFDVEGALNFYALKRTKDKKGVTIPSQI
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgcctaacaagctaaaggaattagtgagtaagaacaaaatacgctatcaggaggatggc
tttgatcttgatctcgcttacattacaaacaacataatcgccatgggatttccagcggag
aatcttgaaggtgtctataggaaccatttggatgatgtccatagactgctggaactgaaa
catggaaaccattacaggatttataatctgtgccaggagaaagagtacgccaaatcaaag
ttcaagggatatgtcataaggtatccattcgaagaccacaaccctccgacgttagagctg
atgagaaatttctgtgaggatgtcaaaaagtggcacgatgaagacctcaaaaatgtagct
gtcatacactgtaaagctggcaagggcagaacaggcgtcatgatctgtgcctacctcgtc
tacataaataaattcgacgtcgagggagctctaaatttttatgccttaaagaggaccaaa
gataaaaaaggtgtgaccatacctagccagatt

DBGET integrated database retrieval system