KEGG   Helobdella robusta: HELRODRAFT_180922
Entry
HELRODRAFT_180922 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K09850  Ras association domain-containing protein 1
Organism
hro  Helobdella robusta
SSDB
Motif
Pfam: Nore1-SARAH RA Ras_bdg_2
Other DBs
NCBI-GeneID: 20207901
NCBI-ProteinID: XP_009028462
JGI: Helro1_180922
UniProt: T1FGF2
LinkDB
Position
Unknown
AA seq 523 aa
MDVRRLPKRHPSTENHPLIAKDDDDDDDSTFHCHTEVFIKPASPQKRVCSKNNITAENSY
STNNLPSTNKNKKELTLTSANHNGTGLYETIIEQLACRLSMNTMLKNIVLTPFKTCSHQR
RSRSWNRLRNESKERRLFGDDSDCCNEVNHYSNRRKDEIELNQFTGIKAMVRSHGHKFEY
VIMNKATWCDKCVCLYTCHITCKNMVTLKCPSLQINNLIINVRKCKLETALSLQPKLSVT
SYDEEDNSINTSNACDSKNGSSIKITYNKMLDFEEKVKTFNESNKFGLFFRLMPTSMQGS
IRVHMNLCRPITMLASTPPPSLLCDDLSQSRAYKTSFHMPKDTSKLIYINDNTTAMEVVE
LLLKKFCIVESPKQFSLYQKTIIHDDVHTMRKLNENDLPLVLCLHWFYQGAEALDSNKFI
LQETDAGDIKWDIFSTPELENFLCMLHREEKEHEERIRGKNKMMKLHIQRRLKEIIKENN
LRANNSGSSGFISSFSSCTSIETSDGFDPKLKTHSCTNMLNYL
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggatgttcgtagacttccaaaaagacatccttcaacggaaaatcatcctttgatagca
aaagatgacgacgacgacgatgattccacttttcactgccatactgaagtttttattaaa
ccagcttcccctcagaaacgtgtttgctcaaaaaataacatcacagcagagaattcttac
agtacaaataatcttccatccacaaacaaaaataaaaaggaattaacattaacatctgcc
aaccataatgggacaggcctctatgaaacaatcattgaacagctggcctgtcgactttcc
atgaatacaatgctcaagaacattgtactgactccattcaaaacatgctctcaccagagg
cggtcaagaagttggaacagattgagaaatgaatcaaaggagaggagattgtttggtgat
gacagtgattgctgcaacgaggtcaaccattactctaatagaaggaaagatgaaattgaa
ttaaatcaatttactgggattaaggcaatggtcagaagtcatggccacaagtttgagtat
gtgataatgaacaaggccacctggtgtgacaaatgtgtctgcttgtacacttgtcacata
acgtgcaagaacatggtgacgctgaagtgtccctccctacaaatcaacaacctcatcatc
aacgtcaggaagtgcaagttggaaactgcactcagtttgcagcctaaattgtctgttact
tcctacgacgaagaagataacagcatcaacacgtctaatgcctgtgattctaagaatgga
agtagcattaaaattacatacaacaagatgttagattttgaagaaaaagtcaaaacattc
aatgagagcaacaagtttggtctcttcttccgactgatgccaacatcgatgcaaggttca
ataagagttcacatgaatctttgccgaccgatcacgatgcttgcatcaactccacctcct
tcgttattgtgcgatgatctgagccagtcaagagcttacaagacatcatttcacatgccc
aaagatacatcaaaactcatttatataaacgataacacgacagcaatggaagtagttgaa
ctgctgttgaagaaattttgcatcgtcgaaagtccaaagcaattttctctctaccagaag
acaataatccacgatgatgttcataccatgagaaagttgaatgagaacgacctaccgctt
gtcctctgtcttcattggttctaccagggtgcagaagctctggattccaataaattcatt
cttcaggaaactgatgctggagatattaagtgggatatcttcagtactccggaactggaa
aacttcctgtgcatgttgcacagggaagagaaggagcacgaggaaagaatcagagggaag
aataagatgatgaagcttcacatccaaagaagactcaaagagatcataaaggagaacaac
ttgagggctaacaacagcggcagtagtggttttatatccagttttagcagttgtaccagt
attgaaacgtctgatggattcgatcctaagcttaaaactcattcttgtactaatatgtta
aattacttgtga

DBGET integrated database retrieval system