KEGG   Helobdella robusta: HELRODRAFT_186529Help
Entry
HELRODRAFT_186529 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hro  Helobdella robusta
Pathway
hro00010  Glycolysis / Gluconeogenesis
hro00030  Pentose phosphate pathway
hro00051  Fructose and mannose metabolism
hro00052  Galactose metabolism
hro01100  Metabolic pathways
hro01200  Carbon metabolism
hro01230  Biosynthesis of amino acids
hro03018  RNA degradation
Module
hro_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HELRODRAFT_186529
   00030 Pentose phosphate pathway
    HELRODRAFT_186529
   00051 Fructose and mannose metabolism
    HELRODRAFT_186529
   00052 Galactose metabolism
    HELRODRAFT_186529
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    HELRODRAFT_186529
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hro01009]
    HELRODRAFT_186529
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hro03019]
    HELRODRAFT_186529
Enzymes [BR:hro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HELRODRAFT_186529
Protein phosphatases and associated proteins [BR:hro01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HELRODRAFT_186529
Messenger RNA biogenesis [BR:hro03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     HELRODRAFT_186529
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 20210554
NCBI-ProteinID: XP_009025449
JGI: Helro1_186529
UniProt: T1FP07
LinkDB All DBs
Position
Unknown
AA seq 799 aa AA seqDB search
MDDSAALGKIQKSQSICVTAGTEGKKIEKDCYSGCVIGVFTSGGDSQGMNAATRAIVRMG
IYVGCKVYLIKEGYQGMVDGGSNIVLADWKSVSNIIQSGGTIIGSARCADFRERPGRLQA
AYNLLERGITNLVCIGGDGSLTGANLFRIEWSSLLEELVKTGRITSQKAQECAHLNVVGL
VGSIDNDFCGTDMTIGTDSALHRIIEAIDNINTTASSHQRCFVMEVMGRHCGYLALVAAL
ASEADWVFIPESPPEKGWEDKLCEKLAQERSLGQRLNIIIVSEGAIDEEGRPITADQIKD
LISKRLKYDTRVTILGHVQRGGNPSAFDRLLGCRMGAEAVLALMEATPFTPACVISLNGN
QIVRVPLMECVARTKEVQAAMDKKEFQKAVELRGRDFVANLESFRTLARARAPKKAFCTA
FNLAVVFVGAPACGMNAAVRSFVRIGITKGFRILGIKNGFEGLVNNEVVSLSWTDVHGWS
GSGGARLKTNRTTPSKVGLDRVADKLRHFSIHGLLIIGGFEAFESILQLTEARSAYREFC
IPMSMVPATISNNIPGTDFSLGSDTSLNAIVEIADRIKQSASGTRNRVFVLETMGGHCGY
LATLSALASGADAAYIFEEPFNITDLQGDVNHLASKIRGGVKRGMVMRNEKANENYTSDF
ITRLYQEEGRNIFQCRLNVLGHMQQGGQPSPFDRNMGTKMAAKCAELLAKQVEENKTPEG
SVFTNSSDTATLLGLQKKRSLFTPVLELKEKTDFQHRISKEVWWCKLRPLLRILAMHNSI
YEVEGQENDGFDDLDKLYL
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggatgattcagctgcacttgggaaaatccaaaagagccagagcatttgtgtgactgct
gggacagaaggtaaaaaaattgagaaagattgctacagtggctgtgtcattggtgtcttc
acgagtggcggtgattcccaaggtatgaatgctgcaacaagagccattgttaggatggga
atctatgttggctgcaaagtctaccttatcaaagaaggctaccaaggaatggttgatgga
gggtcaaacattgttttggcagattggaagtccgtgtccaacatcatacagtctggaggt
accataatcggaagtgctcgatgtgcggacttcagagagaggccgggtcgcttgcaagca
gcatacaacttgttggaacgtggcatcaccaacctcgtgtgcatagggggagatggcagt
cttacgggggccaacctcttcagaatcgaatggtccagtcttcttgaagaacttgttaag
acaggtcgaataaccagtcagaaagcccaggaatgtgctcatctgaatgttgtgggactc
gtcggatcgatcgacaacgacttctgcgggaccgacatgacaattgggactgactctgct
ctgcaccggataattgaggccattgataacatcaacactacagcttccagtcaccagaga
tgttttgtgatggaagttatgggcagacattgtggctacttggccctggtcgctgcgttg
gcttcggaggcagattgggttttcatccctgagagtccgccggagaagggatgggaggac
aagctgtgtgagaaattggcgcaggaaagaagtttgggacagaggttgaacatcatcatc
gtctctgaaggcgccattgatgaggagggcaggcccatcactgctgaccaaatcaaagat
ttgatcagcaagagactgaagtacgacactcgagtgaccatattgggccatgttcagcga
ggaggcaatccatccgcattcgatcgcctgcttggatgtcggatgggtgctgaggctgtg
ctggccctgatggaggccactcccttcactcccgcctgcgtcatctccctgaatggcaac
cagatagtgagggtgcccctcatggagtgtgtggctaggacaaaggaggttcaggctgct
atggataagaaagagtttcaaaaagcggttgagcttagaggcagagattttgtggccaat
ttggaatcatttcgcacactagctagggccagagcaccgaagaaagctttctgtacagca
ttcaacctggcagttgtgtttgttggtgcaccggcctgcggaatgaatgcagccgttcgt
tccttcgttcgtatcgggatcaccaaggggttcagaatccttggcatcaagaacggattt
gaaggcctcgtcaataatgaggtggtgtcattgtcatggactgacgttcatggatggtcc
ggttcgggaggagccaggttgaagactaacaggacgacaccatcgaaagttggattggat
cgtgtagcggataaattgcgacatttcagcatccacggtctccttatcattggtggattc
gaggcatttgagagcatcttgcagttgacggaagctcgttcagcgtacagagagttctgc
ataccaatgtccatggtgcccgccaccatctccaacaatattcctggcactgacttcagt
ctcggatcagatacttctctcaatgctatcgttgagatagcagaccgcatcaaacaatct
gcctcaggaactcgcaatcgagtgttcgtgctggagacgatgggtggacactgcggctac
ctggccacactcagcgccctggccagtggtgctgatgctgcttacatcttcgaggaacca
ttcaacatcaccgaccttcagggagatgtgaatcatcttgcatccaaaatacgagggggt
gtcaagagaggcatggtcatgagaaatgagaaggccaacgagaactacacgagtgacttc
ataacacgtttgtaccaggaggagggcaggaacatcttccagtgcagactgaatgtcctt
ggtcacatgcaacaaggtggtcagccgagtccattcgaccgcaacatgggaacgaagatg
gccgccaagtgcgcggaactgctagccaaacaagtcgaggagaacaaaacaccagaagga
agcgtcttcacgaactcctcagacacagccacactgctaggcctgcagaagaagaggagt
ctcttcacgccagtcctcgaacttaaagaaaaaactgactttcaacatcgcatatcgaag
gaggtgtggtggtgcaagttgcggccactacttcgcatactggccatgcacaacagcatc
tacgaggtcgagggacaggagaacgatggcttcgatgaccttgataagttgtatttgtaa

DBGET integrated database retrieval system