KEGG   Helobdella robusta: HELRODRAFT_194130Help
Entry
HELRODRAFT_194130 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
hro  Helobdella robusta
Pathway
hro04120  Ubiquitin mediated proteolysis
hro04140  Autophagy - animal
hro04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    HELRODRAFT_194130
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    HELRODRAFT_194130
   04140 Autophagy - animal
    HELRODRAFT_194130
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hro04131]
    HELRODRAFT_194130
   04121 Ubiquitin system [BR:hro04121]
    HELRODRAFT_194130
Enzymes [BR:hro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     HELRODRAFT_194130
Membrane trafficking [BR:hro04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    HELRODRAFT_194130
Ubiquitin system [BR:hro04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    HELRODRAFT_194130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-TRAF zf-C3HC4_2 zf-C3HC4_4 zf-RING_UBOX zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-TRAF_2 TFIIA Prok-RING_4
Motif
Other DBs
NCBI-GeneID: 20212899
NCBI-ProteinID: XP_009028589
JGI: Helro1_194130
UniProt: T1FVQ3
LinkDB All DBs
Position
Unknown
AA seq 745 aa AA seqDB search
MSETNSNAEHVPPSEAGQPQQMIQTQQTQTQETQVRQQAIQQIVTSHQQSSLNNNAGTFR
SRSVAGAERNAVTFQIDQAMFVSFQQQQSAAPPQRSGLSSGNNRNGNTRFQPLHHPLDQR
RNEPRPGNSRQLQQQTQRQRLWLQPQQPRQQRQPQQQQQQQQQQQQQQQPRAEPSGPTSP
PPFGYDNTFESELDSRFYCPICLAVLKEVMQTKCGHRFCKSCLKRTENSHNRSLRCPVDK
TFLSMNNPKDVFPDIATDREVRSLRVHCSNQAIGCSWKGELNNFDKHVEQCMKDSIACVF
NCGMTFNRTEIEAHLLKCTKKKEACPHCQAEMFSIELAKHQLINCPKLPVQCVLCGETNL
TRGSLQEHMETVCPSVQVHCSHSSLGCNFKDQRSRMPMHYTAEINYHGHLAREKFSEHSR
WLCILNDQYVDCSNKLDTLEEKLRNLESMWNQNKLLSHACSKWNPMDNVGHDGKLFWKVF
IPQKGPKVITSPHFFIGYNPGYRFIVKLYFPNSNENAPVKAVLLCKPSQLNEYSLKFPID
GFLKISLPSQTGRLVEFSTSLESRLEEGSSSREATNNLTFNSADLSGDRRTSTVCKKKTR
PPPEYRNAANSDHYLFDSSDSSSSSFFNDSFGTNSQKNKPKKIDRKMPAKNFHVMKYFEN
LYPHYLTNCSGQSFRTPPTRREDQQQQQQQQQRELAPSSGYQAQHQMAKKKDRVCVHLLT
RNEMHEKCFEMEGQIFVHVEVKLYF
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaactaactcgaacgccgaacacgttccaccaagtgaagcaggacagcctcag
cagatgatacaaactcaacagacacaaactcaagagacccaggttcgacagcaagcaatt
cagcagattgtgacatcccatcagcaaagcagcttaaacaacaatgctgggacatttcgg
tcaagaagtgttgctggtgctgagcggaacgcggtgacgttccaaatagatcaagcaatg
ttcgtttccttccaacaacagcagtcagcagccccgccacagcgtagcggcctcagcagc
ggcaataatagaaacggtaatactcgattccaaccgctacaccatcctcttgatcagaga
cgcaatgagccacgaccaggtaacagtcgtcaacttcagcaacaaacacaaagacaacgt
ttgtggctgcaaccacaacagccgcgacaacagcggcagccgcagcagcaacagcagcag
caacaacaacagcaacaacaacaacagccgagagctgaaccgagcggaccaacttcaccg
ccgccgtttggttacgacaacacatttgaatctgagttggattcaagattctactgtccc
atctgtctagcagttctcaaagaggtcatgcaaacaaaatgtggtcacagattctgcaaa
agttgccttaagcggacagaaaatagccataatagatcgttacgatgccctgttgacaag
accttcctgagtatgaacaacccaaaagatgtatttcctgatattgccaccgatagggag
gtgaggtccctcagggtccactgtagcaatcaggccatcggatgttcttggaagggagag
ctaaacaattttgataaacacgtggaacaatgtatgaaagactcaattgcctgcgtgttc
aactgtggcatgacttttaacaggacagagatcgaggctcacctactgaaatgtaccaaa
aaaaaggaggcttgcccccactgtcaagccgaaatgttctctatcgagttggccaaacac
cagctgataaactgtcccaagctacctgttcaatgtgtgctgtgtggggagacgaaccta
acgaggggaagcttgcaagaacacatggagactgtttgtccgtctgttcaagttcattgc
tcccattcgtctctgggttgtaattttaaagaccagcgttctcggatgcccatgcactac
accgctgagattaactaccacggccatctggctagagaaaaattttcagaacattccaga
tggttgtgtatactgaatgatcaatatgtggactgcagtaacaaattagatactttggag
gaaaaattgcgtaacctggaaagtatgtggaatcaaaataaacttttgtcccacgcttgt
tcgaagtggaaccccatggataacgtcggtcacgatggcaagctcttctggaaagtcttc
attccgcaaaaaggtcccaaagtaattaccagtccccacttcttcattggatacaatccc
ggatacagattcatcgtcaaactctactttccaaattcaaacgagaacgcgcccgtgaag
gcagtcctactctgcaagccctctcaactgaacgaatattcgctcaaatttccaatcgat
ggttttttaaagatttctctcccatcccagaccggcaggttggttgagttttcgacgtcc
cttgagtcacggctggaggagggcagtagcagcagagaagccacgaacaatctaaccttc
aacagcgccgatctttctggagacagaagaaccagcacagtttgcaaaaaaaagacgaga
ccacctccagaatatcgtaatgctgctaattccgaccactacttatttgactcttcagat
tcttcctcgtcgtcatttttcaacgattcctttggcacaaatagtcaaaagaataaaccg
aaaaaaattgaccgcaagatgcctgcaaaaaattttcacgtgatgaaatattttgaaaat
ttgtacccgcattatttaacaaattgttctggtcaatcttttcggactccgccaacacga
agggaagatcaacagcagcagcagcagcagcagcagcgagagttggcaccatcatcgggt
tatcaagcacaacatcaaatggccaaaaagaaagatagagtatgcgttcatttgctgacg
agaaatgaaatgcacgagaaatgttttgaaatggagggccaaatattcgttcatgttgaa
gttaaattgtacttttga

DBGET integrated database retrieval system