KEGG   Helobdella robusta: HELRODRAFT_194553Help
Entry
HELRODRAFT_194553 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
hro  Helobdella robusta
Pathway
hro04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hro00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    HELRODRAFT_194553
Enzymes [BR:hro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     HELRODRAFT_194553
Chromosome and associated proteins [BR:hro03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     HELRODRAFT_194553
   HDAC complexes
    Sin3A-HDAC complex
     HELRODRAFT_194553
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    HELRODRAFT_194553
  Chromatin remodeling factors
   NuRD complex
    HELRODRAFT_194553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl GREB1
Motif
Other DBs
NCBI-GeneID: 20213065
NCBI-ProteinID: XP_009030811
JGI: Helro1_194553
UniProt: T1FW69
LinkDB All DBs
Position
Unknown
AA seq 628 aa AA seqDB search
MALMGDHSKRKICYYYDGDIGNYYYGQGHPMKPQRIRMCHNLLLNYGLYRKMEIYRPHKA
SQDEMTRFHSDDYIKFLKSIRPDNMSDFNKQMQRFNVGEDCPVFDGLYEFCQLSTGGSIA
GAVKLNKQATDIAINWSGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTMSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPLRDGINDESYEQ
VFQPVMSKVMEMFQPSAVVLQCGADSLSGDRLGCFNLSLKGHGKCVEFVRRFNLPTLMVG
GGGYTIRNVARCWTYETSIALQTEIANELPYNDYFEYYGPDFKLHINPSNMTNQNTTEYL
DKIKSRLFENLRMLPHAPGVQMADIVDDALKEESDDEDKQNPDERISIRASDKRIACDDE
FSDSEDEGGRTTTADGQKKNKESNRTKRMKLDDEKNSASTSTTTSVTTTVTTTASAATVV
GGAGDGTGVAVDAKDVKVDLPKDTINQISSTSSSSTSTANTPQQSATTTVATSSLTTTAP
STSNSTIDPIKAPTAVVDSSSNSQITMVTANSKSDAPLVAKQDKAPSTSTPPPSLTTNSN
ATSLTNTTITCTTSSVSSVVESSEHTAQ
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggctttaatgggcgatcacagcaaaaggaagatttgctattattatgatggtgatata
gggaattattattacggacaggggcaccctatgaagccccagcgaattaggatgtgccac
aatctcctgctcaattatggactgtacagaaaaatggagatatatcgtccccataaggct
tcacaagatgagatgacccgattccacagtgacgactacataaagttcctgaagagcata
cggccagacaacatgtccgacttcaacaaacagatgcagcgattcaacgtcggtgaggat
tgccctgtgttcgacggcctttacgagttctgtcagctgtctactggagggtccattgct
ggggcagtgaagttgaacaagcaggcgacagacatcgccataaattggtcaggtggcctg
catcacgccaagaagtctgaggcatctggattctgttatgtcaatgatattgtactggcc
atactggaattgctcaaataccatcagagggtgctgtacatcgacatagacatccaccat
ggtgacggtgtggaggaggccttctacaccacggatcgtgtcatgacaatgtccttccac
aagtatggtgaatactttccaggaaccggtgatctcagggacattggagctggcaagggc
aaatactatgccgtaaactttccattgcgagatggcatcaatgatgagtcctatgaacaa
gttttccaacctgtgatgtccaaagtgatggagatgtttcagccatcggcagttgttctt
cagtgtggtgctgattccctgtcaggtgaccggctgggatgcttcaatctctcactgaag
ggacacggcaagtgtgtcgagttcgttcgtcgattcaaccttccaaccctgatggttggc
ggtgggggctacaccatcaggaacgtggccaggtgttggacctatgagacttccatcgcc
cttcagactgaaattgctaatgaattgccatacaatgattacttcgagtactatggcccc
gacttcaaactgcacatcaacccgtccaacatgaccaaccagaacaccaccgagtacctg
gacaagatcaaaagcagattgtttgaaaatctcagaatgctgccacatgctcccggggtg
cagatggctgatatagttgatgatgctttgaaggaggaaagtgatgatgaagataagcaa
aatccagatgaaagaatatcaataagagccagcgacaagcggattgcgtgcgacgacgag
ttctcagatagtgaggacgaaggtggaagaacgaccaccgcagatggacagaaaaaaaat
aaagaaagtaatagaacaaagaggatgaagttggatgatgaaaagaattcagcttctact
tccactaccaccagcgtcaccaccaccgttactactactgcttctgctgctactgtggtc
ggtggagccggggatggtacaggcgtcgctgttgatgccaaggacgtgaaagttgatctt
ccaaaggacacgatcaaccagatatcgtcaacatcgtcgtcatctacatcaacagcaaac
acaccacagcagtcggcaacaacaacggtagcaacatcgtcgttaacgacaacagctcca
tcgacttccaactccacaatagatccaataaaagcccccacagcagttgtcgactcatcc
tccaattcccaaattaccatggtaactgccaatagcaaatctgatgccccattggtagcc
aaacaagacaaagccccttccacatcaactcctcctccatctctgacaaccaatagtaat
gccaccagcctgacgaatactacaattacttgtactacttcatccgtatcgtccgttgtt
gaaagtagcgagcatactgcccagtga

DBGET integrated database retrieval system