KEGG   Helobdella robusta: HELRODRAFT_65129Help
Entry
HELRODRAFT_65129  CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K01245  ADP-ribosylarginine hydrolase [EC:3.2.2.19]
Organism
hro  Helobdella robusta
Brite
KEGG Orthology (KO) [BR:hro00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HELRODRAFT_65129
Enzymes [BR:hro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.19  [protein ADP-ribosylarginine] hydrolase
     HELRODRAFT_65129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADP_ribosyl_GH DUF1128
Motif
Other DBs
NCBI-GeneID: 20213733
NCBI-ProteinID: XP_009019705
JGI: Helro1_65129
UniProt: T1FY35
LinkDB All DBs
Position
Unknown
AA seq 391 aa AA seqDB search
MTNTCTYKKTHTQAPTHPHTHTHTHTHTHTHTTHTHRYKAAMLLGGAADAIGFYKGTWEF
EISGDKIHQEVKKMGGIGALNVKKPQWIVSDDTVMHLATAEAIIEYGKSRSGDIKKLYQM
VAKHYHVSMHDMNGRSPGITCTHGVSQLKPNRPDGYMIPFNDKGGGCGGAMRSMCIGMYY
PKPEQIDSLVALSIECGRMTHNHPTGYLGSLASALFTHYAVQGKPAHCWGAGLMETLELA
WEYVKKEGRDVDKNQLHWNYFKNAWADYLKVRGLTDGKSPPKFPDVYGVLERDKFYKKVS
YSGWGGSSGHDAPMIAYDAFLGSGDSWEELSNRAFFHGGDSDSTAIIAATWFGIMYGTKG
VPAGNYQNLEYKDRLEDAGSKIFDLVEYLFS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatacatgcacttacaaaaaaacacacacacaagcacccacccacccacacaca
cacacacacacacacacacacacacacacacacacaacacacacacataggtacaaggca
gctatgttgttgggaggtgctgctgatgcaattgggttttacaagggaacatgggagttt
gagatatctggtgacaaaattcatcaagaggtcaaaaagatgggtggaataggagctttg
aatgttaaaaaacctcaatggattgtgtcagatgatactgtcatgcatcttgccacagct
gaagccataattgaatatgggaagagcaggtctggtgatataaaaaagttgtaccagatg
gtggcgaaacattatcatgtttccatgcacgacatgaacggcagatcaccaggtataaca
tgcacgcatggcgtctcacagttgaaaccaaacagacctgatggatacatgatacctttc
aatgacaagggaggtggatgcggaggtgctatgaggtccatgtgcattggcatgtattac
ccaaaacctgaacaaattgattcgttggttgctctgagcattgagtgcggtcgcatgacc
cacaaccatccaaccggctacttaggatcgttagcatctgctttgttcactcactacgct
gttcaaggaaaacccgctcattgctggggtgctggcctgatggagacgttggaactcgca
tgggaatatgtgaagaaagaaggaagagatgttgacaaaaatcaactgcattggaattac
tttaaaaatgcatgggcggactatttgaaggtgcgcggtttaactgacggaaagtcacca
ccgaagtttccagacgtctacggcgttttggaaagggacaagttttacaagaaagtaagt
tacagtggctggggaggttcctcgggacacgacgcccctatgatagcgtatgacgcattt
ttagggtcaggagatagttgggaggaactatcgaatcgagcattttttcatggtggtgac
agtgacagcactgccatcatagctgccacatggtttggtatcatgtatgggactaaaggg
gtcccggccggaaattatcagaacttagaatacaaagatcgccttgaagatgctggaagc
aaaatttttgatttggtcgaatatttattcagctaa

DBGET integrated database retrieval system