KEGG   Helobdella robusta: HELRODRAFT_78629Help
Entry
HELRODRAFT_78629  CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
hro  Helobdella robusta
Pathway
hro04068  FoxO signaling pathway
hro04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hro00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    HELRODRAFT_78629
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    HELRODRAFT_78629
Enzymes [BR:hro01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     HELRODRAFT_78629
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N VHS
Motif
Other DBs
NCBI-GeneID: 20215586
NCBI-ProteinID: XP_009017316
JGI: Helro1_78629
UniProt: T1G3D8
LinkDB All DBs
Position
Unknown
AA seq 260 aa AA seqDB search
MHFSHLIVLLFCVQNSFSLSPHEVPAENLIEYPLPKLEYDFDDLEPYIDGATVRAHYNGH
HESYRKKMNEFLQKWRSSVSSKLPYQSLYQILQNLNKVPHDLEISILNNVGGYVNHALYW
SILSPNPSKQLRLPEGHLLERIKSDFDSFDEFKNKFTAEALKLFGSGYVWLVSEKPNFDG
SEGRLRIVSSSNQDSPITFKLLPLLVIDVWEHAYYLKHQYKRVEHVEDFWYLVDWKKVDA
LVKFWEEFNWELHGTYREDL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcacttttctcatttgatcgttttgttattttgtgtgcaaaattccttttcattatct
ccacacgaagtacctgccgaaaatctgattgagtatcctctgcctaagttagagtacgac
tttgatgatttggaaccttacattgacggggccactgtgagggcgcattacaacggccac
catgaatcttacagaaaaaagatgaatgaatttctgcaaaaatggcgttcatcagtttca
agcaagcttccatatcagtccttgtatcaaatcttacaaaatctcaataaagtgcctcat
gatttagaaataagcattctcaataatgtcggaggatatgtcaatcatgcactttattgg
agcatcttgtcaccgaacccgagcaagcagttgagacttccagagggtcatctgcttgag
aggatcaaatcagactttgacagttttgatgagttcaaaaacaagttcactgcagaagca
ttgaaattatttggttcaggatatgtctggttagtgtcagagaaaccaaattttgatgga
tcagaaggtcgtcttagaatagtttcttcatccaatcaagattcacctatcactttcaag
ctcctcccacttcttgtgatcgacgtatgggagcatgcatactacttgaagcaccagtat
aaaagggtggagcatgttgaggacttctggtatttggtggattggaagaaagttgatgca
ctggtaaagttctgggaggagtttaactgggagttgcatggaacgtacagggaggactta
tga

DBGET integrated database retrieval system