KEGG   Helobdella robusta: HELRODRAFT_89336Help
Entry
HELRODRAFT_89336  CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
hro  Helobdella robusta
Pathway
hro04068  FoxO signaling pathway
hro04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    HELRODRAFT_89336
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    HELRODRAFT_89336
Enzymes [BR:hro01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     HELRODRAFT_89336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Gly_radical
Motif
Other DBs
NCBI-GeneID: 20216969
NCBI-ProteinID: XP_009029364
JGI: Helro1_89336
UniProt: T1G7C2
LinkDB All DBs
Position
Unknown
AA seq 203 aa AA seqDB search
MAVRSKHKLPDLPYDFNALEPYISADIMKIHYEKHHQAYVTNLNIAEEKLAEAQAKGDIK
TIISLAPALRFNGGGHINHSIFWQNLGPKSAEEPTGDLKAAIDRDFGSFDNLKTQLSTAS
VAVQGSGWGWLGYNKQSGKLQVATCPNQDPLEPTTGLIPLFGIDVWEHAYYLQYKNVRPD
YVKAIWNVANWKDIAERLAKAKK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggccgttagaagcaagcacaagctgccggatttgccgtatgatttcaacgcccttgaa
ccgtacatatctgctgacataatgaagattcattatgaaaaacaccaccaagcctacgtc
actaatcttaatattgcagaagagaaactggctgaagctcaagctaagggtgacattaag
actataatatctctggcccctgcactgagattcaatggtggtggccacatcaaccattca
attttctggcagaatcttggccctaaatctgcagaggagcccactggcgacttgaaagca
gccattgacagagattttggatcttttgataacctaaaaacccaacttagcacagccagc
gtggcagttcagggctcgggttggggttggttggggtacaacaaacagtcaggtaaactt
caggtggccacctgtcctaatcaagaccccttagagcccactactggattgatcccattg
tttgggatcgatgtgtgggagcatgcttactacctccagtacaaaaatgtccgacctgat
tatgtcaaggccatctggaatgttgccaactggaaagatattgcggagagattggctaag
gccaaaaaatga

DBGET integrated database retrieval system