KEGG   Helobdella robusta: HELRODRAFT_94219Help
Entry
HELRODRAFT_94219  CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
hro  Helobdella robusta
Pathway
hro00020  Citrate cycle (TCA cycle)
hro00190  Oxidative phosphorylation
hro01100  Metabolic pathways
hro01200  Carbon metabolism
Module
hro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hro_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hro_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:hro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HELRODRAFT_94219
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HELRODRAFT_94219
Enzymes [BR:hro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     HELRODRAFT_94219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA HI0933_like FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 20217541
NCBI-ProteinID: XP_009016064
JGI: Helro1_94219
UniProt: T1G8Z4
LinkDB All DBs
Position
Unknown
AA seq 663 aa AA seqDB search
MASVFQRIFTCQNSLNLGKKLPGSVLSSRPFSFRVHGRNENAKHSTGQQLSRDYPVVDHE
YDAVVVGAGGAGLRAAFGLANKGFKTACITKLFPTRSHTVAAQGGVNAALSNMESDRWEY
HFYDTVKGSDWLGDQDAIQYMCEEAPKAVTELENFGMPFSRLENGKIYQRAFGGQSLDFG
KGGQAHRACCVADRTGHSMLHTLYGRSLKYDADYFIEYFALDLIMENGQCKGVLALSLED
GNIHRFRCNNTVLATGGYGRCYFSCTGAHTCTGDGNAMANRAGIYNQDMEFIQFHPTGIY
GAGCLITEGCRGEGGFLVNSKGERFMERYAPNAKDLASRDVVSRSMTIEIREGRGVGKDK
DHIYLQLFHLPPEQLHARLPGISETAMIFAGVDVTREPVPVLPTVHYNMGGVPTNYLGQV
VQSKNGQDYIVPGLFACGEAASTSVHGANRLGANSLLDLVVFGRACANTIETLNKPGDPA
PRIDQNAGEATVANLDAIRHAKGTISTADLRLKMQKVMQEYAAVFRDGPTLKTGCEKLSA
LYKELPNLKTTDRGMIWNSDLVESLELQNLMINSMLSAFTAENRKESRGAHAREDFPTRI
DELDYSKPLEGQKKKTFAEHWRKHSLAHVDVATGKVSIDYRAVNDKVLDSSKVQTIPPKI
RSY
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgtttttcagcgaattttcacttgtcaaaattctcttaatctcggaaagaaa
ttgcctggatcagtgctttcctcaaggccatttagctttcgagtccatggaagaaacgaa
aatgcaaaacacagtactggacaacaactttcaagagattaccctgtagtggatcatgag
tatgatgcagtggtggttggagctggtggtgcaggtttaagagcagcattcggtcttgca
aataagggattcaaaactgcttgtatcactaaacttttcccaacacgttctcatactgtg
gctgctcagggaggtgtaaatgcagctctgtctaacatggaatcagatagatgggaatat
cacttttatgataccgtgaaaggatctgattggttaggcgatcaagatgccatccaatac
atgtgtgaagaagccccaaaagctgttactgagctagagaactttggcatgcccttcagt
cgattggagaatggcaagatttaccagagagcatttggtgggcagagtttggattttgga
aaggggggacaagcgcacagagcttgctgtgtggcagataggacaggacattccatgctt
catacactctatgggaggtcactgaaatatgatgctgactacttcatcgagtacttcgcc
ctggatctcatcatggagaatggacagtgtaaaggtgtcctggccctctctctcgaagat
ggtaacattcatcgtttcagatgcaacaatactgtcctagctactggtggatatggtaga
tgttacttctcgtgcactggagctcacacctgcactggcgatgggaatgccatggcaaac
agagctggcatctacaaccaggatatggagtttatccaatttcatcccactggtatttat
ggagcaggatgcttgattacagaaggttgcagaggtgagggtggtttccttgtgaacagc
aagggtgaacgattcatggagagatatgctcccaatgctaaggatctggcttccagggac
gttgtatccaggtctatgactattgagatcagagaaggaagaggtgtaggcaaggacaaa
gaccacatctacctgcaacttttccatctgccccctgagcaacttcatgctcgtttgcct
ggaatttctgaaactgcaatgatctttgctggggttgatgtaactcgtgaaccagtccct
gtcctacctactgttcactacaacatgggtggcgtccctaccaactatcttggacaagtc
gtccagtctaagaatggacaggattatattgttcctggattgtttgcatgtggtgaggca
gccagtacatccgttcacggtgctaacaggttgggagccaactccttattggatctcgtt
gtctttggtcgtgcatgtgctaatactattgagacactcaataagccaggagatcctgct
ccacgtattgaccagaatgctggtgaggcgacagttgccaacctggatgccatcagacat
gcaaagggaacaatatcaactgcagatctcaggctgaaaatgcagaaggtgatgcaagag
tatgcagcagttttccgtgatgggccaacactgaagactggatgtgagaagttgtctgca
ctctacaaggagctacctaatctcaagacaacagatcgtggaatgatctggaactctgat
ctggtagaaagcctggaacttcagaatctcatgatcaactccatgctgtctgcattcact
gcagagaatcgtaaagagagcagaggggcacatgccagagaagacttccctacaagaatc
gacgagcttgattattcaaaaccgctggaaggtcaaaagaagaaaacatttgctgagcac
tggcgcaagcactcgcttgctcatgtggatgttgctactgggaaggtgtcgattgattat
cgtgctgtcaatgataaagtcctcgacagcagcaaagttcagaccataccgccgaaaatc
cgttcctactaa

DBGET integrated database retrieval system