KEGG   Helobdella robusta: HELRODRAFT_96716Help
Entry
HELRODRAFT_96716  CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
hro  Helobdella robusta
Pathway
hro00052  Galactose metabolism
hro00500  Starch and sucrose metabolism
hro01100  Metabolic pathways
hro04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    HELRODRAFT_96716
   00500 Starch and sucrose metabolism
    HELRODRAFT_96716
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    HELRODRAFT_96716
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hro04147]
    HELRODRAFT_96716
Enzymes [BR:hro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     HELRODRAFT_96716
Exosome [BR:hro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HELRODRAFT_96716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 20217681
NCBI-ProteinID: XP_009010012
JGI: Helro1_96716
UniProt: T1G9D4
LinkDB All DBs
Position
Unknown
AA seq 918 aa AA seqDB search
MMIAAYVSSAATALALLCHVIAAAEEDVVVLNSDNDQNTICDVNPYVYRFDCHPEYYSSP
SRCNNRGCCWRDTLSSSSSSINDDSINTIVNNDGKSSSKIGRPYCYFPVNYPSYKVTQWA
ETNYGYRAVLIKEASSPWPNDILNLTLYIWFQSQTVLHFKIVDSKNARYEVPIEMPKPPA
VKPSTTDYSVEYFSSPFGLKVLRKSTGATLFNSIISTAPLIYADQFLQISTLLDSPWLYG
LGENYGPLLIDATQYRKFTFWARDQIPIMHSNLYGAHPFYMNIEKSKEAHGVFFLNSNAM
EVDVQPAPALTFRTIGGVLDFYIFTGPTLENVVQQYVQTIGIPAMPPFWGLGFHLCRWKY
NNIDRLKTIIKRNKDIGIPYDVQWSDIDYMENEKLWTYDKVNYNGLPQLIDQLHKDTMKY
IIILDPGISDKYPGRYPPYDRGVQQNVFIRNYTGHILQGQVWPGPTVYPDFTHPNATSWW
LKDAEDFHKVLPYDGLWIDMNEPSNFVSGSSVGCTMNNLDRPPFVPAISGDGTLEFKTLC
GSARQHVSTHYNLHNMYGLHEAMATHEVLLKIMKKRSLSVSRSTFPSHGKYGQHWTGDVR
ATWTDLYYSIPGLLNFQMFGIPFVGADVCGFSGNSNEELCIRWTQLGAFYPFMRNHNDGD
SIDQDPGAWGTSAQKIMKEAIELRYSLLPFMYTQFYLNQLDGSPVIRPLSFAFQADVETY
KIDKQFLWGSSLLISPILERGKFNLTAYFPSGGWYDVFNHFKLTSVGRYYYLNTPLNKIN
LHLREGNIIPWQQSAVTTAKSRKNAINLMAGLDTKQAATGQLFWDDGDSLDTIGKKLYTL
IKFTASRGTLYGKVQLKGYRPVDELRLGSIAILGVDRKPTTLLLNNKTKEFQWRDDVNEI
FITNANVTLLEEFTTVWI
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcgccgcttacgttagcagtgcagctactgctttggctcttttgtgtcatgtg
atagcagcagcagaagaagacgtagtagtattaaacagtgacaacgaccagaacacaatc
tgtgatgtcaatccctatgtatatagattcgattgccaccccgaatactattcctctcca
tccaggtgtaacaacaggggctgctgttggcgagatactttgagtagtagcagtagcagt
attaatgatgacagtattaatactattgtcaataatgatggaaaaagtagtagcaaaatt
ggcagaccatactgctactttcctgtcaactatccttcgtacaaagtcactcagtgggca
gaaactaattatggttacagagctgtcttgatcaaggaggcatcatcaccctggcctaat
gatattctaaatttgactctttatatttggttccaaagtcaaacagtccttcatttcaag
attgtggattcgaaaaatgcaaggtacgaggtcccaatcgaaatgcctaagccaccagct
gtcaaaccatcaacaactgattattctgtagaatatttctcgtcaccttttggtctcaag
gttctcagaaaaagtactggagcaacattattcaacagtataatctcgacagcgcccctc
atatatgcggatcagtttctgcagattagtacacttctcgattcgccttggctgtacggt
ctgggggagaactacggcccactcctcatcgacgccacccagtatcgaaagttcaccttc
tgggctcgcgatcaaattcctatcatgcattcaaatttgtatggggcccacccattctac
atgaacattgaaaagagcaaagaggcccatggagttttctttcttaacagcaatgcaatg
gaggtggatgttcagcccgcaccggctctgaccttcagaacgataggaggcgtccttgac
ttctacatcttcaccgggccaaccctggagaatgtcgtgcaacagtacgttcagacgatc
ggcattcccgccatgccgccattctggggactggggttccatctctgtaggtggaaatat
aacaacatcgacaggttgaagaccatcatcaagagaaataaagatattggcattccatac
gacgttcaatggagtgatatagattatatggagaatgaaaaactctggacttacgacaag
gtcaattataatggcttgcctcagctaatagaccaattacataaggacactatgaaatat
attatcatactggacccgggtataagtgacaaataccccggcaggtacccaccatacgat
cgaggggtacaacaaaacgtattcatacgaaactataccgggcatattcttcaggggcag
gtgtggcccgggccgaccgtctaccctgatttcacccatcccaatgctactagctggtgg
ctgaaagatgccgaagattttcacaaagttctaccgtatgacggactgtggattgacatg
aacgagccatcgaatttcgtctccgggtcttcagtcggatgtacgatgaataatctggat
cgtcctccctttgttcctgccataagtggcgatggaacattagagtttaagacactgtgt
ggttcagccaggcagcacgtatcgacccactacaatcttcataatatgtacggtctacac
gaagctatggctactcacgaagtcctcttaaaaataatgaagaagaggtccctgtcggta
tctagatcgacttttccaagtcatggaaagtacggccagcattggactggagacgtcaga
gcaacctggaccgatctttattattctatcccaggcttgttgaacttccaaatgtttggc
attccattcgtcggggctgatgtgtgtggattctctggcaactctaatgaagaactctgc
atcagatggactcaactcggcgccttctacccatttatgagaaatcataatgatggagat
agcattgaccaagatccaggagcgtggggtacatcggcccagaagataatgaaagaggcc
atcgaacttaggtattcactcctgcccttcatgtacactcagttttatttgaaccaacta
gatggaagccccgtcatcagaccgttgtccttcgctttccaagctgacgttgaaacgtac
aagattgacaaacagttcttgtggggtagctctctactcattagtcccatcctcgagcgg
ggtaagttcaacttgacggcctacttcccaagcggcggatggtacgacgtgttcaaccac
ttcaagttaacgagcgtcggaaggtactactacttgaacacccccctcaacaaaataaac
ctccacctaagagagggaaatatcatcccgtggcaacagtcagctgttactacggccaaa
agtcgcaaaaatgcgatcaacttgatggccggtttggatacgaaacaagcagctactggc
caattgttttgggatgatggtgactcgttagacaccattggaaagaagttgtacactctt
ataaagttcacagcttccagaggcactttatacggtaaagtacaattgaagggctacagg
ccggttgacgagttgaggctgggttcgatcgcgatcctgggtgtcgataggaaaccgact
acgctgctgctcaataacaagacgaaagaatttcagtggagggatgatgttaatgaaata
ttcatcacgaacgcaaatgtaacactactggaagagtttaccaccgtatggatttaa

DBGET integrated database retrieval system