KEGG   Halovivax ruber: Halru_1263Help
Entry
Halru_1263        CDS       T02402                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hru  Halovivax ruber
Pathway
hru00010  Glycolysis / Gluconeogenesis
hru00053  Ascorbate and aldarate metabolism
hru00071  Fatty acid degradation
hru00280  Valine, leucine and isoleucine degradation
hru00310  Lysine degradation
hru00330  Arginine and proline metabolism
hru00340  Histidine metabolism
hru00380  Tryptophan metabolism
hru00410  beta-Alanine metabolism
hru00620  Pyruvate metabolism
hru00625  Chloroalkane and chloroalkene degradation
hru01100  Metabolic pathways
hru01110  Biosynthesis of secondary metabolites
hru01120  Microbial metabolism in diverse environments
hru01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halru_1263
   00053 Ascorbate and aldarate metabolism
    Halru_1263
   00620 Pyruvate metabolism
    Halru_1263
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Halru_1263
   00561 Glycerolipid metabolism
    Halru_1263
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Halru_1263
   00310 Lysine degradation
    Halru_1263
   00330 Arginine and proline metabolism
    Halru_1263
   00340 Histidine metabolism
    Halru_1263
   00380 Tryptophan metabolism
    Halru_1263
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Halru_1263
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Halru_1263
Enzymes [BR:hru01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Halru_1263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGB15877
UniProt: L0ID52
LinkDB All DBs
Position
1309443..1310915
Genome map
AA seq 490 aa AA seqDB search
MAYLPLPPESGWTALYRDGEWIDRDDRDVIDVENPYTRESIAKVPAGTPDDIDEAYRIAE
GAQDSWAEQPPQRRAGVVTRALRLLEEHWDDVVELLAIESGSASVKAVAELQTAKGMMQQ
AASYPFTMTGQHRDSIVPGKENVVERVPVGVVGVISPWNFPFHLSMRAVAPAIAAGNAVV
LKPASNTPITGGLLLARLFDEAGLPDGVLNVVPGRGSEIGDAVAEHETPRVLAFTGSTEI
GQRVARKAAGNTALPALELGGNNVHVVTENADLDRAVDGGVFGSFLHQGQACISINRHLV
HESLYDEYVDALADRAANLPVGDPRDEETIIGPIIDESQRDQMLEFVAESVDAGATVETG
GESDGLLVEPTVLSDASNDMAAACNEHFGPIAPVIPYADDAAAIDLANDTIHGLSGSVHS
DDEAQARRIADGIETGMIHINDQPINDEPHVPFGGMKHSGLGRYNADSILDELTTTKWIS
IQREPRQYPF
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatcttcccctgccacccgaatccggctggactgcactctacagagacggcgag
tggatcgaccgcgatgaccgtgacgtaatcgacgtggagaatccctatacccgcgaatcc
atcgcgaaggttcccgcggggacgccggacgacatcgacgaggcctatcggatcgccgag
ggggcccaggactcgtgggccgagcaaccgccgcagcggcgcgccggcgtcgtcactcgt
gcgctccgattactcgaagagcactgggacgacgtcgtcgaactgctggcgatcgaatcg
ggcagtgcgtcggtcaaggcggtcgccgagttgcagacggcgaaggggatgatgcagcag
gcggcgagctacccgttcacgatgacgggccagcaccgcgactcgatcgtccccgggaag
gagaacgtcgtcgaacgcgtgccggtgggtgtcgtcggcgtgatctcgccgtggaacttc
ccctttcacctctcgatgcgcgccgtggcaccggcgatcgccgcggggaacgcggtcgtc
ctgaaacccgcctcgaacacgccgatcaccggcggcctcttgctcgcccgcctcttcgac
gaggccggcctccccgacggcgtcctgaacgtcgtcccgggccgggggtccgagatcggt
gacgccgtggccgagcacgagacgcctcgcgtccttgcgttcaccgggtcgacggagatc
ggccagcgggtggcgcggaaggcagccggcaacaccgcgctccctgccctcgaactcggc
gggaacaacgtccacgtcgtcaccgagaacgccgacctcgaccgggcggtcgacggcggc
gtgttcggctccttcctccaccagggacaggcctgcatctcgatcaatcgccacctggtc
cacgaatcgctgtacgacgagtacgtcgacgccctcgcggatcgcgcggcgaatctgccg
gtcggcgatccgcgtgacgaggagacgatcatcgggccgatcatcgacgagagtcagcgc
gaccagatgctcgaattcgtcgcggagagcgtcgacgccggcgcgaccgtcgagactggc
ggcgagagtgacgggttgctcgtcgaaccgacggtcctctccgacgcgagcaacgacatg
gccgccgcgtgcaacgaacacttcgggcccatcgcgcccgtcatcccgtacgccgacgac
gcggcggcgatcgacctcgccaacgacactatacacggcctctcgggctccgttcactcc
gacgacgaggcgcaggcgcgtcgtatcgccgacgggatcgagacgggcatgattcacatc
aacgaccagccgatcaacgacgaaccgcacgttcccttcggcgggatgaagcactccggc
ctcgggcgctacaacgccgactcgatcctcgacgaactgacgacgaccaagtggatctcg
atacagcgcgagccgcgacagtacccgttctga

DBGET integrated database retrieval system