KEGG   Halovivax ruber: Halru_2700Help
Entry
Halru_2700        CDS       T02402                                 

Definition
(GenBank) prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
hru  Halovivax ruber
Pathway
hru00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hru01100  Metabolic pathways
hru01110  Biosynthesis of secondary metabolites
hru01130  Biosynthesis of antibiotics
hru01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hru00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Halru_2700
Enzymes [BR:hru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     Halru_2700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT
Motif
Other DBs
NCBI-ProteinID: AGB17275
UniProt: L0ICI9
LinkDB All DBs
Position
complement(2727706..2728512)
Genome map
AA seq 268 aa AA seqDB search
MHTVTLGPEGTYSHRAARTVSDSVAFRPSVTAIVEAVADGSFDRGVVPIENSIEGSVTET
LDALAARDVSIVREVVTPITHALLAQAEDFETVTSHSQALAQCRSFLADQYPDVARESVA
STAAAVELAREDPSVAAIAHPSTAEQALRVLATEIQDRPSNETRFFVLGPESARSPAGGK
TTIVIYPASNHPGLLYELLGPFEERGVNLTRIESRPSGKQLGDYRFHLDLEGGLYEPRIE
AAVEAVEAVLDDGWVRWLGSYDVEHAVE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcacaccgtcacgctcggtccggaaggaacgtactcccaccgggccgctcgcaccgtg
agcgattcggtcgcgttccggccgtcggtgacggcgatcgtcgaggcggtcgccgacggg
tcgttcgatcgcggcgtcgtcccgatcgagaacagcatcgagggaagcgtcaccgagacg
ctcgacgcactcgcggcgcgggacgtctcgatcgttcgcgaggtcgtcaccccgatcaca
cacgcgttgctcgcccaggctgaggatttcgagaccgtcacgagccactcccaggcgctc
gcccagtgtcggtcgtttctcgccgaccagtatccagacgttgcgcgcgaatccgtcgcc
agtacggcggcggccgtcgaactggcccgggaggatccgtccgtcgcggccattgcacac
ccgagtacggccgagcaggcccttcgcgtgctcgcgaccgagatccaggatcgtccgtcg
aacgagacgcgatttttcgtgctcgggcccgagtcggctcgttcgccggccggcggaaag
acgacgatcgtcatctatccggcgtccaaccacccggggctgctgtacgaacttctcggc
ccgttcgaggagcggggcgtcaacctcacgcgaatcgaatcccgaccgagcgggaagcaa
ctgggcgactaccgttttcatctcgacctggagggtggactgtacgagccgcgaatcgag
gcggccgtcgaggcggtcgaagccgtcctcgacgacggctgggtgcgctggctcggctcc
tacgacgtggaacacgcggtcgagtga

DBGET integrated database retrieval system