KEGG   Homo sapiens (human): 10005
Entry
10005             CDS       T01001                                 

Gene name
ACOT8, HNAACTE, NAP1, PTE-1, PTE-2, PTE1, PTE2, hACTE-III, hTE
Definition
(RefSeq) acyl-CoA thioesterase 8
  KO
K11992  acyl-CoA thioesterase 8 [EC:3.1.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00120  Primary bile acid biosynthesis
hsa01100  Metabolic pathways
hsa04146  Peroxisome
Module
hsa_M00104  Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Network
nt06022  Bile acid biosynthesis
  Element
N00805  Bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    10005 (ACOT8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    10005 (ACOT8)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.27  choloyl-CoA hydrolase
     10005 (ACOT8)
SSDB
Motif
Pfam: 4HBT_3 Acyl_CoA_thio 4HBT
Other DBs
NCBI-GeneID: 10005
NCBI-ProteinID: NP_005460
OMIM: 608123
HGNC: 15919
Ensembl: ENSG00000101473
Vega: OTTHUMG00000033045
Pharos: O14734(Tbio)
UniProt: O14734
LinkDB
Position
20q13.12
AA seq 319 aa
MSSPQAPEDGQGCGDRGDPPGDLRSVLVTTVLNLEPLDEDLFRGRHYWVPAKRLFGGQIV
GQALVAAAKSVSEDVHVHSLHCYFVRAGDPKLPVLYQVERTRTGSSFSVRSVKAVQHGKP
IFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAA
QEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYIGEGDMKMHCCVAAYISDYAFLGTAL
LPHQWQHKVHFMVSLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRQDGVLAV
TCAQEGVIRVKPQVSESKL
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtcgtccccgcaggccccagaagatgggcagggctgtggcgaccgcggcgatccccct
ggggacctccgtagcgtcttggtcacgaccgtgctcaacctcgagccgctggacgaggat
ctcttcagaggaaggcattactgggtaccggccaagaggctgtttggtggtcagatcgtg
ggccaggccctggtggctgcagccaagtctgtgagtgaagacgtccacgtgcactccctg
cactgctactttgttcgggcaggggacccgaagctgccagtactgtaccaagtggagcgg
acacgaacagggtcgagcttctcggtgcgctctgtgaaggccgtgcaacatgggaagccc
atcttcatctgccaggcctccttccagcaggcccagcccagccccatgcagcaccagttc
tccatgcccactgtgccaccaccagaagagctgcttgactgtgagaccctcattgaccag
tatttaagggaccctaacctccaaaagaggtacccattggcgctcaaccgaattgctgct
caggaggtccccattgagatcaagccagtaaacccatcccccctgagccagctgcagaga
atggagcccaaacagatgttctgggtgcgagcccggggctatattggcgagggcgacatg
aagatgcactgctgcgtggccgcctatatctccgactatgccttcttgggcactgcactg
ctgcctcaccagtggcagcacaaggtgcacttcatggtctcactggaccattccatgtgg
ttccacgcccccttccgagctgaccactggatgctctatgaatgcgagagcccctgggcc
ggtggctctcgggggctggtccatgggcggctgtggcgtcaggatggagtcctagctgtg
acctgtgcccaggagggcgtgatccgagtgaagccccaggtctcagagagcaagctgtag

DBGET integrated database retrieval system