KEGG   Homo sapiens (human): 10013Help
Entry
10013             CDS       T01001                                 

Gene name
HDAC6, CPBHM, HD6, JM21, PPP1R90
Definition
(RefSeq) histone deacetylase 6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
Network
N00375  HPV E7 to TNF-IRF1 signaling pathway
Drug target
Belinostat: D08870
Citarinostat: D10918
Entinostat: D09338
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Ricolinostat: D10661
Romidepsin: D06637
Tucidinostat: D10993
Vorinostat: D06320
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    10013 (HDAC6)
  09164 Substance dependence
   05034 Alcoholism
    10013 (HDAC6)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    10013 (HDAC6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:hsa01009]
    10013 (HDAC6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:hsa03019]
    10013 (HDAC6)
   04131 Membrane trafficking [BR:hsa04131]
    10013 (HDAC6)
   03036 Chromosome and associated proteins [BR:hsa03036]
    10013 (HDAC6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     10013 (HDAC6)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     10013 (HDAC6)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     10013 (HDAC6)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    10013 (HDAC6)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     10013 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 10013
NCBI-ProteinID: NP_001308155
OMIM: 300272
HGNC: 14064
Ensembl: ENSG00000094631
Vega: OTTHUMG00000034496
Pharos: Q9UBN7(Tclin)
UniProt: Q9UBN7 A0A024QZ26
LinkDB All DBs
Structure
PDB: 

Position
Xp11.23
AA seq 1215 aa AA seqDB search
MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLG
QAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLI
QEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNS
YSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQ
KHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQG
QGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATP
AGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSA
QASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSR
TGLVYDQNMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCH
SAEYVGHLRATEKMKTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLN
GAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQTISGHALRILIVDWDVHHGNGTQHMF
EDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGDADYLAAWH
RLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILEG
GYNLTSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVE
DREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSET
AVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGA
ILDQTTSEDAVGGATLGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQ
TPLASSTDHQTPPTSPVQGTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEA
AGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQ
ENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKN
IAHQNKFGEDMPHPH
NT seq 3648 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaaccggccaggattccaccacaaccaggcagcgaagaagtaggcagaacccc
cagtcgccccctcaggactccagtgtcacttcgaagcgaaatattaaaaagggagccgtt
ccccgctctatccccaatctagcggaggtaaagaagaaaggcaaaatgaagaagctcggc
caagcaatggaagaagacctaatcgtgggactgcaagggatggatctgaaccttgaggct
gaagcactggctggcactggcttggtgttggatgagcagttaaatgaattccattgcctc
tgggatgacagcttcccggaaggccctgagcggctccatgccatcaaggagcaactgatc
caggagggcctcctagatcgctgcgtgtcctttcaggcccggtttgctgaaaaggaagag
ctgatgttggttcacagcctagaatatattgatctgatggaaacaacccagtacatgaat
gagggagaactccgtgtcctagcagacacctacgactcagtttatctgcatccgaactca
tactcctgtgcctgcctggcctcaggctctgtcctcaggctggtggatgcggtcctgggg
gctgagatccggaatggcatggccatcattaggcctcctggacatcacgcccagcacagt
cttatggatggctattgcatgttcaaccacgtggctgtggcagcccgctatgctcaacag
aaacaccgcatccggagggtccttatcgtagattgggatgtgcaccacggtcaaggaaca
cagttcaccttcgaccaggaccccagtgtcctctatttctccatccaccgctacgagcag
ggtaggttctggccccacctgaaggcctctaactggtccaccacaggtttcggccaaggc
caaggatataccatcaatgtgccttggaaccaggtggggatgcgggatgctgactacatt
gctgctttcctgcacgtcctgctgccagtcgccctcgagttccagcctcagctggtcctg
gtggctgctggatttgatgccctgcaaggggaccccaagggtgagatggccgccactccg
gcagggttcgcccagctaacccacctgctcatgggtctggcaggaggcaagctgatcctg
tctctggagggtggctacaacctccgcgccctggctgaaggcgtcagtgcttcgctccac
acccttctgggagacccttgccccatgctggagtcacctggtgccccctgccggagtgcc
caggcttcagtttcctgtgctctggaagcccttgagcccttctgggaggttcttgtgaga
tcaactgagaccgtggagagggacaacatggaggaggacaatgtagaggagagcgaggag
gaaggaccctgggagccccctgtgctcccaatcctgacatggccagtgctacagtctcgc
acagggctggtctatgaccaaaatatgatgaatcactgcaacttgtgggacagccaccac
cctgaggtaccccagcgcatcttgcggatcatgtgccgtctggaggagctgggccttgcc
gggcgctgcctcaccctgacaccgcgccctgccacagaggctgagctgctcacctgtcac
agtgctgagtacgtgggtcatctccgggccacagagaaaatgaaaacccgggagctgcac
cgtgagagttccaactttgactccatctatatctgccccagtaccttcgcctgtgcacag
cttgccactggcgctgcctgccgcctggtggaggctgtgctctcaggagaggttctgaat
ggtgctgctgtggtgcgtcccccaggacaccacgcagagcaggatgcagcttgcggtttt
tgctttttcaactctgtggctgtggctgctcgccatgcccagactatcagtgggcatgcc
ctacggatcctgattgtggattgggatgtccaccacggtaatggaactcagcacatgttt
gaggatgaccccagtgtgctatatgtgtccctgcaccgctatgatcatggcaccttcttc
cccatgggggatgagggtgccagcagccagatcggccgggctgcgggcacaggcttcacc
gtcaacgtggcatggaacgggccccgcatgggtgatgctgactacctagctgcctggcat
cgcctggtgcttcccattgcctacgagtttaacccagaactggtgctggtctcagctggc
tttgatgctgcacggggggatccgctggggggctgccaggtgtcacctgagggttatgcc
cacctcacccacctgctgatgggccttgccagtggccgcattatccttatcctagagggt
ggctataacctgacatccatctcagagtccatggctgcctgcactcgctccctccttgga
gacccaccacccctgctgaccctgccacggcccccactatcaggggccctggcctcaatc
actgagaccatccaagtccatcgcagatactggcgcagcttacgggtcatgaaggtagaa
gacagagaaggaccctccagttctaagttggtcaccaagaaggcaccccaaccagccaaa
cctaggttagctgagcggatgaccacacgagaaaagaaggttctggaagcaggcatgggg
aaagtcacctcggcatcatttggggaagagtccactccaggccagactaactcagagaca
gctgtggtggccctcactcaggaccagccctcagaggcagccacagggggagccactctg
gcccagaccatttctgaggcagccattgggggagccatgctgggccagaccacctcagag
gaggctgtcgggggagccactccggaccagaccacctcagaggagactgtgggaggagcc
attctggaccagaccacctcagaggatgctgttgggggagccacgctgggccagactacc
tcagaggaggctgtaggaggagctacactggcccagaccacctcggaggcagccatggag
ggagccacactggaccagactacgtcagaggaggctccagggggcaccgagctgatccaa
actcctctagcctcgagcacagaccaccagacccccccaacctcacctgtgcagggaact
acaccccagatatctcccagtacactgattgggagtctcaggaccttggagctaggcagc
gaatctcagggggcctcagaatctcaggccccaggagaggagaacctactaggagaggca
gctggaggtcaggacatggctgattcgatgctgatgcagggatctaggggcctcactgat
caggccatattttatgctgtgacaccactgccctggtgtccccatttggtggcagtatgc
cccatacctgcagcaggcctagacgtgacccaaccttgtggggactgtggaacaatccaa
gagaattgggtgtgtctctcttgctatcaggtctactgtggtcgttacatcaatggccac
atgctccaacaccatggaaattctggacacccgctggtcctcagctacatcgacctgtca
gcctggtgttactactgtcaggcctatgtccaccaccaggctctcctagatgtgaagaac
atcgcccaccagaacaagtttggggaggatatgccccacccacactaa

DBGET integrated database retrieval system