KEGG   Homo sapiens (human): 100132074Help
Entry
100132074         CDS       T01001                                 

Gene name
FOXO6
Definition
(RefSeq) forkhead box O6
  KO
K17847  forkhead box protein O6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100132074 (FOXO6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    100132074 (FOXO6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    100132074 (FOXO6)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    100132074 (FOXO6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Forkhead FOXO-TAD FOXO_KIX_bdg TauE
Motif
Other DBs
NCBI-GeneID: 100132074
NCBI-ProteinID: NP_001278210
OMIM: 611457
HGNC: 24814
UniProt: A0A1X9RU27
LinkDB All DBs
Position
1p34.2
AA seq 559 aa AA seqDB search
MAAKLRAHQVDVDPDFAPQSRPRSCTWPLPQPDLAGDEDGALGAGVAEGAEDCGPERRAT
APAMAPAPPLGAEVGPLRKAKSSRRNAWGNLSYADLITKAIESAPDKRLTLSQIYDWMVR
YVPYFKDKGDSNSSAGWKNSIRHNLSLHTRFIRVQNEGTGKSSWWMLNPEGGKTGKTPRR
RAVSMDNGAKFLRIKGKASKKKQLQAPERSPDDSSPSAPAPGPVPAAAKWAASPASHASD
DYEAWADFRGGGRPLLGEAAELEDDEALEALAPSSPLMYPSPASALSPALGSRCPGELPR
LAELGGPLGLHGGGGAGLPEGLLDGAQDAYGPRARAGTPAYFGGCKGGAYGGGGGFGPPA
MGALRRLPMQTIQENKQASFVPAAAPFRPGALPALLPPPPPAPRPGPVLGAPGELALAGA
AAAYPGKGAAPYAPPAPSRSALAHPISLMTLPGEAGAAGLAPSGHAAAFGGPPGGLLLDA
LPGPYAAAAAGPLGAAPDRFPADLDLDMFSGSLECDVESIILNDFMDSDEMDFNFDSALP
PPPPGLAGAPPPNQSWVPG
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgaagctgcgagcgcatcaggtggacgtggacccggacttcgcgccgcagagc
cggccgcgctcgtgtacctggcccctgccgcagcctgacttggccggcgacgaggacgga
gcgctgggcgcaggggtggccgagggcgccgaggactgcgggccggagcgccgggctacg
gccccggcgatggccccagcgccgcccctgggcgcggaggtcggaccgctgcggaaagcg
aagagctctcggcggaacgcgtgggggaacctgtcctacgccgacctcatcaccaaagcc
atcgagagcgccccggacaagcggctcacgctctcgcagatctacgactggatggtccgt
tacgtgccctacttcaaggataaaggcgacagcaacagctcggccggctggaagaactcc
atccggcacaacctgtcgctgcacacccgtttcatccgcgtgcagaacgagggcaccggc
aagagttcgtggtggatgctgaaccccgagggcggaaagacagggaagaccccgcggcgc
agggccgtgtccatggacaacggggccaagttcctgcgcatcaagggcaaggcgagcaag
aagaagcagctgcaggcgcccgagcgaagcccggacgacagctccccgagtgcgcccgcc
ccggggccggtgcctgccgcagccaagtgggccgccagccccgcctcgcacgccagcgac
gactacgaggcttgggccgacttccgcggcggcgggagacccctgctcggggaggcggcc
gagctggaggacgacgaggccctggaggccctggcgccatcatcgccgctcatgtaccca
agccccgccagcgcgctgtcgccggcgctgggctcgcgctgtccgggtgagctgccccgc
ctggccgagctgggaggcccgctgggcctgcacggcggcggcggcgcggggctgcccgag
ggcctgctggacggcgcgcaggacgcgtacgggccgcgggcccgcgccgggacgcccgcc
tacttcggcggctgcaagggcggcgcctacggcgggggcgggggcttcgggccgccggcg
atgggcgctctgcgccgtctgcccatgcagaccatccaggagaacaagcaggccagcttc
gtgccggccgcggcgcccttccgccctggggcgctgcccgcgctgctgccgccgccgccg
cccgcgcccaggcccggcccggtgctgggtgcgccgggggagctggcgctggcgggcgca
gccgccgcctaccccggcaaaggggcggccccgtacgcgccgcccgcgccctcgcgcagt
gccttagcccaccccatcagccttatgacgctgcccggcgaggcgggcgccgcgggcctg
gcaccgtcgggccacgccgccgccttcgggggcccgcccggcggcctcctgctggacgct
ctgccggggccctacgctgccgccgccgccgggccgctgggcgccgcgcccgaccgcttc
ccggccgacctggacctcgacatgttcagcgggagcctcgagtgcgacgtggagtccatc
atcctcaacgacttcatggacagcgacgaaatggacttcaacttcgattcggccctgcct
ccaccgccgccgggcctggccggggccccgccccccaaccagagctgggtgccgggctga

DBGET integrated database retrieval system