KEGG   Homo sapiens (human): 100132285Help
Entry
100132285         CDS       T01001                                 

Gene name
KIR2DS2, 183ActI, CD158J, CD158b, KIR-2DS2, NKAT-5, NKAT5, cl-49
Definition
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 2
  KO
K07982  killer cell immunoglobulin-like receptor 2DS
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100132285 (KIR2DS2)
   04612 Antigen processing and presentation
    100132285 (KIR2DS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    100132285 (KIR2DS2)
CD molecules [BR:hsa04090]
 Proteins
  100132285 (KIR2DS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ig Ig_3 Ig_2
Motif
Other DBs
NCBI-GeneID: 100132285
NCBI-ProteinID: NP_036444
OMIM: 604953
HGNC: 6334
Pharos: P43631(Tdark)
UniProt: P43631 K7R1S5
LinkDB All DBs
Structure
PDB: 

Position
19q13.4
AA seq 304 aa AA seqDB search
MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLL
HREGKYKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGT
FQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHVLIGTSVVKIPFTILLFFLLHRWCSNKKNAAVMDQEPAGNRTVNSEDSDEQDHQE
VSYA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcatggtcgtcagcatggcgtgtgttgggttcttcttgctgcagggggcctgg
ccacatgagggagtccacagaaaaccttccctcctggcccacccaggtcccctggtgaaa
tcagaagagacagtcatcctgcaatgttggtcagatgtcaggtttgagcacttccttctg
cacagagaggggaagtataaggacactttgcacctcattggagagcaccatgatggggtc
tccaaggccaacttctccatcggtcccatgatgcaagaccttgcagggacctacagatgc
tacggttctgttactcactccccctatcagttgtcagctcccagtgaccctctggacatc
gtcatcacaggtctatatgagaaaccttctctctcagcccagccgggccccacggttttg
gcaggagagagcgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggagggggaggcccatgaacgtaggttctctgcagggcccaaggtcaacggaaca
ttccaggccgactttcctctgggccctgccacccacggaggaacctacagatgcttcggc
tctttccgtgactctccctatgagtggtcaaactcgagtgacccactgcttgtttctgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctccaaaaccggtaac
cccagacacctgcatgttctgattgggacctcagtggtcaaaatccctttcaccatcctc
ctcttctttctccttcatcgctggtgctccaacaaaaaaaatgctgctgtaatggaccaa
gagcctgcagggaacagaacagtgaacagcgaggattctgatgaacaagaccatcaggag
gtgtcatacgcataa

KEGG   Homo sapiens (human): 3806Help
Entry
3806              CDS       T01001                                 

Gene name
KIR2DS1, CD158H, CD158a, p50.1
Definition
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 1
  KO
K07982  killer cell immunoglobulin-like receptor 2DS
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3806 (KIR2DS1)
   04612 Antigen processing and presentation
    3806 (KIR2DS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3806 (KIR2DS1)
CD molecules [BR:hsa04090]
 Proteins
  3806 (KIR2DS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ig Ig_3 Ig_2
Motif
Other DBs
NCBI-GeneID: 3806
NCBI-ProteinID: NP_055327
OMIM: 604952
HGNC: 6333
Pharos: Q14954(Tdark)
UniProt: Q14954
LinkDB All DBs
Position
19q13.4
AA seq 304 aa AA seqDB search
MSLTVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLL
HREGMFNDTLRLIGEHHDGVSKANFSISRMKQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGT
FQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGN
PRHLHVLIGTSVVKIPFTILLFFLLHRWCSDKKNAAVMDQEPAGNRTVNSEDSDEQDHQE
VSYA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcacggtcgtcagcatggcgtgtgttgggttcttcttgctgcagggggcctgg
ccacatgagggagtccacagaaaaccttccctcctggcccacccaggtcgcctggtgaaa
tcagaagagacagtcatcctgcaatgttggtcagatgtcatgtttgaacacttccttctg
cacagagaggggatgtttaacgacactttgcgcctcattggagaacaccatgatggggtc
tccaaggccaacttctccatcagtcgcatgaagcaagacctggcagggacctacagatgc
tacggttctgttactcactccccctatcagttgtcagctcccagtgaccctctggacatc
gtgatcataggtctatatgagaaaccttctctctcagcccagccgggccccacggttctg
gcaggagagaatgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggaaggggaggcccatgaacgtaggctccctgcagggaccaaggtcaacggaaca
ttccaggccaactttcctctgggccctgccacccatggagggacctacagatgcttcggc
tctttccgtgactctccatacgagtggtcaaagtcaagtgacccactgcttgtttctgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctccgaaaccggtaac
cccagacacctacatgttctgattgggacctcagtggtcaaaatccctttcaccatcctc
ctcttctttctccttcatcgctggtgctccgacaaaaaaaatgctgctgtaatggaccaa
gagcctgcagggaacagaacagtgaacagcgaggattctgatgaacaagaccatcaggag
gtgtcatacgcataa

KEGG   Homo sapiens (human): 3808Help
Entry
3808              CDS       T01001                                 

Gene name
KIR2DS3, NKAT7
Definition
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 3
  KO
K07982  killer cell immunoglobulin-like receptor 2DS
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3808 (KIR2DS3)
   04612 Antigen processing and presentation
    3808 (KIR2DS3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3808 (KIR2DS3)
CD molecules [BR:hsa04090]
 Proteins
  3808 (KIR2DS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ig Ig_3 Ig_2
Motif
Other DBs
NCBI-GeneID: 3808
NCBI-ProteinID: NP_036445
OMIM: 604954
HGNC: 6335
Pharos: Q14952(Tdark)
UniProt: Q14952 K7QT50
LinkDB All DBs
Position
19q13.4
AA seq 304 aa AA seqDB search
MSLMVISMACVGFFWLQGAWPHEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLL
HREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGT
FQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHVLIGTSVVKLPFTILLFFLLHRWCSDKKNASVMDQGPAGNRTVNREDSDEQDHQE
VSYA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcatggtcatcagcatggcatgtgttgggttcttctggctgcagggggcctgg
ccacatgagggattccgcagaaaaccttccctcctggcccacccaggtcgcctggtgaaa
tcagaagagacagtcatcctgcaatgttggtcagatgtcatgtttgagcacttccttctg
cacagagaggggacgtttaacgacactttgcgcctcattggagagcacattgatggggtc
tccaaggccaacttctccatcggtcgcatgaggcaagacctggcagggacctacagatgc
tacggttctgttcctcactccccctatcagttttcagctcccagtgaccctctggacatc
gtgatcacaggtctatatgagaaaccttctctctcagcccagccgggccccacggttctg
gcaggagagagcgtgaccttgtcctgcagctcctggagctcctatgacatgtaccatcta
tccacggagggggaggcccatgaacgtaggttctctgcagggcccaaggtcaacggaaca
ttccaggccgactttcctctgggccctgccacccaaggaggaacctacagatgcttcggc
tctttccatgactctccctacgagtggtcaaagtcaagtgacccactgcttgtttctgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctccaaaaccggtaac
cccagacacctacacgttctgattgggacctcagtggtcaaactccctttcaccatcctc
ctcttctttctccttcatcgctggtgctccgacaaaaaaaatgcatctgtaatggaccaa
gggcctgcggggaacagaacagtgaacagggaggattctgacgaacaggaccatcaggag
gtgtcatacgcataa

KEGG   Homo sapiens (human): 3809Help
Entry
3809              CDS       T01001                                 

Gene name
KIR2DS4, CD158I, KIR-2DS4, KIR1D, KIR412, KKA3, NKAT-8, NKAT8
Definition
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 4
  KO
K07982  killer cell immunoglobulin-like receptor 2DS
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3809 (KIR2DS4)
   04612 Antigen processing and presentation
    3809 (KIR2DS4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3809 (KIR2DS4)
CD molecules [BR:hsa04090]
 Proteins
  3809 (KIR2DS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ig Ig_3 Ig_2
Motif
Other DBs
NCBI-GeneID: 3809
NCBI-ProteinID: NP_036446
OMIM: 604955
HGNC: 6336
Ensembl: ENSG00000221957
Vega: OTTHUMG00000065932
Pharos: P43632(Tdark)
UniProt: P43632 A0A0C4ZN05
LinkDB All DBs
Structure
PDB: 

Position
19q13.42
AA seq 304 aa AA seqDB search
MSLMVIIMACVGFFLLQGAWPQEGVHRKPSFLALPGHLVKSEETVILQCWSDVMFEHFLL
HREGKFNNTLHLIGEHHDGVSKANFSIGPMMPVLAGTYRCYGSVPHSPYQLSAPSDPLDM
VIIGLYEKPSLSAQPGPTVQAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAVRSINGT
FQADFPLGPATHGGTYRCFGSFRDAPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHVLIGTSVVKIPFTILLFFLLHRWCSDKKNAAVMDQEPAGNRTVNSEDSDEQDHQE
VSYA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcatggtcatcatcatggcgtgtgttgggttcttcttgctgcagggggcctgg
ccacaggagggagtccacagaaaaccttccttcctggccctcccaggtcacctggtgaaa
tcagaagagacagtcatcctgcaatgttggtcggatgtcatgtttgagcacttccttctg
cacagagaggggaagtttaacaacactttgcacctcattggagagcaccatgatggggtt
tccaaggccaacttctccattggtcccatgatgcctgtccttgcaggaacctacagatgc
tacggttctgttcctcactccccctatcagttgtcagctcccagtgaccctctggacatg
gtgatcataggtctatatgagaaaccttctctctcagcccagccgggccccacggttcag
gcaggagagaatgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggaaggggaggcccatgaacgtaggctccctgcagtgcgcagcatcaacggaaca
ttccaggccgactttcctctgggccctgccacccacggagggacctacagatgcttcggc
tctttccgtgacgctccctacgagtggtcaaactcgagtgatccactgcttgtttccgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctccaaaaccggtaac
cccagacacctacatgttctgattgggacctcagtggtcaaaatccctttcaccatcctc
ctcttctttctccttcatcgctggtgctccgacaaaaaaaatgctgctgtaatggaccaa
gagcctgcagggaacagaacagtgaacagcgaggattctgatgaacaagaccatcaggag
gtgtcatacgcataa

KEGG   Homo sapiens (human): 3810Help
Entry
3810              CDS       T01001                                 

Gene name
KIR2DS5, CD158G, NKAT9
Definition
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 5
  KO
K07982  killer cell immunoglobulin-like receptor 2DS
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3810 (KIR2DS5)
   04612 Antigen processing and presentation
    3810 (KIR2DS5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3810 (KIR2DS5)
CD molecules [BR:hsa04090]
 Proteins
  3810 (KIR2DS5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ig Ig_3 Ig_2 Ig_4
Motif
Other DBs
NCBI-GeneID: 3810
NCBI-ProteinID: NP_055328
OMIM: 604956
HGNC: 6337
UniProt: Q14953
LinkDB All DBs
Position
19q13.4
AA seq 304 aa AA seqDB search
MSLMVISMACVAFFLLQGAWPHEGFRRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLL
HREGTFNHTLRLIGEHIDGVSKGNFSIGRMTQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNRT
FQADFPLDPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNSSNSWPSPTEPSSETGN
PRHLHVLIGTSVVKLPFTILLFFLLHRWCSNKKNASVMDQGPAGNRTVNREDSDEQDHQE
VSYA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcatggtcatcagcatggcgtgtgttgcgttcttcttgctgcagggggcctgg
ccacatgagggattccgcagaaaaccttccctcctggcccacccaggtcccctggtgaaa
tcagaagagacagtcatcctgcaatgttggtcagatgtcatgtttgagcacttccttctg
cacagagaggggacgtttaaccacactttgcgcctcattggagagcacattgatggggtc
tccaagggcaacttctccatcggtcgcatgacacaagacctggcagggacctacagatgc
tacggttctgttactcactccccctatcagttgtcagcgcccagtgaccctctggacatc
gtgatcacaggtctatatgagaaaccttctctctcagcccagccgggccccacggttctg
gcaggagagagcgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggaaggggaggcccatgaacgtaggctccctgcagggcccaaggtcaacagaaca
ttccaggccgactttcctctggaccctgccacccacggagggacctacagatgcttcggc
tctttccgtgactctccatacgagtggtcaaagtcaagtgacccactgcttgtttctgtc
acaggaaactcttcaaatagttggccttcacccactgaaccaagctccgaaaccggtaac
cccagacacctacacgttctgattgggacctcagtggtcaaactccctttcaccatcctc
ctcttctttctccttcatcgctggtgctccaacaaaaaaaatgcatctgtaatggaccaa
gggcctgcggggaacagaacagtgaacagggaggattctgatgaacaggaccatcaggag
gtgtcatacgcataa

DBGET integrated database retrieval system