KEGG   Homo sapiens (human): 100132463Help
Entry
100132463         CDS       T01001                                 

Gene name
CLDN24, CLDN21
Definition
(RefSeq) claudin 24
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100132463 (CLDN24)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100132463 (CLDN24)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100132463 (CLDN24)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    100132463 (CLDN24)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100132463 (CLDN24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    100132463 (CLDN24)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100132463 (CLDN24)
  Exosomal proteins of colorectal cancer cells
   100132463 (CLDN24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like
Motif
Other DBs
NCBI-GeneID: 100132463
NCBI-ProteinID: NP_001172078
HGNC: 37200
Ensembl: ENSG00000185758
Vega: OTTHUMG00000160628
Pharos: A6NM45(Tdark)
UniProt: A6NM45
LinkDB All DBs
Position
4q35.1
AA seq 220 aa AA seqDB search
MALIFRTAMQSVGLLLSLLGWILSIITTYLPHWKNLNLDLNEMENWTMGLWQTCVIQEEV
GMQCKDFDSFLALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRIGESQRDLKRRLLI
LGGILSWASGITALVPVSWVAHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGG
CLLNCAACSSHAPLALGHYAVAQMQTQCPYLEDGTADPQV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggctttaatctttagaacagcaatgcaatctgttggacttttactatctctcctggga
tggattttatccattattacaacttatttgccacactggaagaacctcaacctggactta
aatgaaatggaaaactggaccatgggactctggcaaacctgtgtcatccaagaggaagtg
gggatgcaatgcaaggactttgactccttcctggctttgcctgctgaactcagggtctcc
aggatcttaatgtttctgtcaaatgggctgggatttctgggcctgctggtctctgggttt
ggcctggactgtttgagaattggagagagtcagagagatctcaagaggcgactgctcatt
ctgggaggaattctgtcctgggcctcgggaatcacagccctggttcccgtctcttgggtt
gcccacaagacggttcaggagttctgggatgagaacgtcccagactttgtccccaggtgg
gagtttggggaggccctgtttctgggctggtttgctggactttctcttctgctaggaggg
tgtctgctcaactgcgcagcctgctccagccacgctcccctagctttgggccactatgca
gtggcgcaaatgcaaactcagtgtccctacctggaagatgggacagcagatcctcaagtg
taa

KEGG   Homo sapiens (human): 10686Help
Entry
10686             CDS       T01001                                 

Gene name
CLDN16, HOMG3, PCLN1
Definition
(RefSeq) claudin 16
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Disease
H01210  Hypomagnesemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    10686 (CLDN16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    10686 (CLDN16)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    10686 (CLDN16)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10686 (CLDN16)
  09172 Infectious disease: viral
   05160 Hepatitis C
    10686 (CLDN16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10686 (CLDN16)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   10686 (CLDN16)
  Exosomal proteins of colorectal cancer cells
   10686 (CLDN16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DuoxA
Motif
Other DBs
NCBI-GeneID: 10686
NCBI-ProteinID: NP_006571
OMIM: 603959
HGNC: 2037
Ensembl: ENSG00000113946
Vega: OTTHUMG00000156215
Pharos: Q9Y5I7(Tbio)
UniProt: Q9Y5I7
LinkDB All DBs
Position
3q28
AA seq 305 aa AA seqDB search
MTSRTPLLVTACLYYSYCNSRHLQQGVRKSKRPVFSHCQVPETQKTDTRHLSGARAGVCP
CCHPDGLLATMRDLLQYIACFFAFFSAGFLIVATWTDCWMVNADDSLEVSTKCRGLWWEC
VTNAFDGIRTCDEYDSILAEHPLKLVVTRALMITADILAGFGFLTLLLGLDCVKFLPDEP
YIKVRICFVAGATLLIAGTPGIIGSVWYAVDVYVERSTLVLHNIFLGIQYKFGWSCWLGM
AGSLGCFLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETAKMYA
VDTRV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgacctccaggaccccactgttggttacagcctgtttgtattattcttactgcaactca
agacacctgcagcagggcgtgagaaaaagtaaaagaccagtattttcacattgccaggta
ccagaaacacagaagactgacacccgccacttaagtggggccagggctggtgtctgccca
tgttgccatcctgatgggctgcttgccacaatgagggatcttcttcaatacatcgcttgc
ttctttgcctttttctctgctgggtttttgattgtggccacctggactgactgttggatg
gtgaatgctgatgactctctggaggtgagcacaaaatgccgaggcctctggtgggaatgc
gtcacaaatgcttttgatgggattcgcacctgtgatgagtacgattccatacttgcggag
catcccttgaagctggtggtaactcgagcgttgatgattactgcagatattctagctggg
tttggatttctcaccctgctccttggtcttgactgcgtgaaattcctccctgatgagccg
tacattaaagtccgcatctgctttgttgctggagccacgttactaatagcaggtacccca
ggaatcattggctctgtgtggtatgctgttgatgtgtatgtggaacgttctactttggtt
ttgcacaatatatttcttggtatccaatataaatttggttggtcctgttggctcggaatg
gctgggtctctgggttgctttttggctggagctgttctcacctgctgcttatatcttttt
aaagatgttggacctgagagaaactatccttattccttgaggaaagcctattcagccgcg
ggtgtttccatggccaagtcatactcagcccctcgcacagagacggccaaaatgtatgct
gtagacacaagggtgtaa

KEGG   Homo sapiens (human): 1364Help
Entry
1364              CDS       T01001                                 

Gene name
CLDN4, CPE-R, CPER, CPETR, CPETR1, WBSCR8, hCPE-R
Definition
(RefSeq) claudin 4
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    1364 (CLDN4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    1364 (CLDN4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    1364 (CLDN4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    1364 (CLDN4)
  09172 Infectious disease: viral
   05160 Hepatitis C
    1364 (CLDN4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1364 (CLDN4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   1364 (CLDN4)
  Exosomal proteins of colorectal cancer cells
   1364 (CLDN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 TMEM37 DUF4131 Amastin
Motif
Other DBs
NCBI-GeneID: 1364
NCBI-ProteinID: NP_001296
OMIM: 602909
HGNC: 2046
Ensembl: ENSG00000189143
Vega: OTTHUMG00000023425
Pharos: O14493(Tbio)
UniProt: O14493 Q75L80
LinkDB All DBs
Position
7q11.23
AA seq 209 aa AA seqDB search
MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTG
QMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIV
AGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGL
LCCNCPPRTDKPYSAKYSAARSAAASNYV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggcctccatggggctacaggtaatgggcatcgcgctggccgtcctgggctggctggcc
gtcatgctgtgctgcgcgctgcccatgtggcgcgtgacggccttcatcggcagcaacatt
gtcacctcgcagaccatctgggagggcctatggatgaactgcgtggtgcagagcaccggc
cagatgcagtgcaaggtgtacgactcgctgctggcactgccgcaggacctgcaggcggcc
cgcgccctcgtcatcatcagcatcatcgtggctgctctgggcgtgctgctgtccgtggtg
gggggcaagtgtaccaactgcctggaggatgaaagcgccaaggccaagaccatgatcgtg
gcgggcgtggtgttcctgttggccggccttatggtgatagtgccggtgtcctggacggcc
cacaacatcatccaagacttctacaatccgctggtggcctccgggcagaagcgggagatg
ggtgcctcgctctacgtcggctgggccgcctccggcctgctgctccttggcggggggctg
ctttgctgcaactgtccaccccgcacagacaagccttactccgccaagtattctgctgcc
cgctctgctgctgccagcaactacgtgtaa

KEGG   Homo sapiens (human): 1365Help
Entry
1365              CDS       T01001                                 

Gene name
CLDN3, C7orf1, CPE-R2, CPETR2, HRVP1, RVP1
Definition
(RefSeq) claudin 3
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    1365 (CLDN3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    1365 (CLDN3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    1365 (CLDN3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    1365 (CLDN3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    1365 (CLDN3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1365 (CLDN3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   1365 (CLDN3)
  Exosomal proteins of colorectal cancer cells
   1365 (CLDN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 TMEM37 L_HMGIC_fpl
Motif
Other DBs
NCBI-GeneID: 1365
NCBI-ProteinID: NP_001297
OMIM: 602910
HGNC: 2045
Ensembl: ENSG00000165215
Vega: OTTHUMG00000023424
Pharos: O15551(Tbio)
UniProt: O15551 Q75L79
LinkDB All DBs
Position
7q11.23
AA seq 220 aa AA seqDB search
MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNIITSQNIWEGLWMNCVVQSTGQ
MQCKVYDSLLALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVA
GVLFLLAALLTLVPVSWSANTIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALL
CCSCPPREKKYTATKVVYSAPRSTGPGASLGTGYDRKDYV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgggcctggagatcacgggcaccgcgctggccgtgctgggctggctgggcacc
atcgtgtgctgcgcgttgcccatgtggcgcgtgtcggccttcatcggcagcaacatcatc
acgtcgcagaacatctgggagggcctgtggatgaactgcgtggtgcagagcaccggccag
atgcagtgcaaggtgtacgactcgctgctggcactgccacaggaccttcaggcggcccgc
gccctcatcgtggtggccatcctgctggccgccttcgggctgctagtggcgctggtgggc
gcccagtgcaccaactgcgtgcaggacgacacggccaaggccaagatcaccatcgtggca
ggcgtgctgttccttctcgccgccctgctcaccctcgtgccggtgtcctggtcggccaac
accattatccgggacttctacaaccccgtggtgcccgaggcgcagaagcgcgagatgggc
gcgggcctgtacgtgggctgggcggccgcggcgctgcagctgctggggggcgcgctgctc
tgctgctcgtgtcccccacgcgagaagaagtacacggccaccaaggtcgtctactccgcg
ccgcgctccaccggcccgggagccagcctgggcacaggctacgaccgcaaggactacgtc
taa

KEGG   Homo sapiens (human): 1366Help
Entry
1366              CDS       T01001                                 

Gene name
CLDN7, CEPTRL2, CLDN-7, CPETRL2, Hs.84359, claudin-1
Definition
(RefSeq) claudin 7
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    1366 (CLDN7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    1366 (CLDN7)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    1366 (CLDN7)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    1366 (CLDN7)
  09172 Infectious disease: viral
   05160 Hepatitis C
    1366 (CLDN7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1366 (CLDN7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   1366 (CLDN7)
  Exosomal proteins of colorectal cancer cells
   1366 (CLDN7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 SUR7 Clc-like Amastin OppC_N
Motif
Other DBs
NCBI-GeneID: 1366
NCBI-ProteinID: NP_001171951
OMIM: 609131
HGNC: 2049
Ensembl: ENSG00000181885
Vega: OTTHUMG00000178005
Pharos: O95471(Tbio)
UniProt: O95471 A0A384ME58
LinkDB All DBs
Position
17p13.1
AA seq 211 aa AA seqDB search
MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTG
MMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAM
GGGIIFIVAGLAALVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGA
LLSCSCPGNESKAGYRVPRSYPKSNSSKEYV
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggccaattcgggcctgcagttgctgggcttctccatggccctgctgggctgggtgggt
ctggtggcctgcaccgccatcccgcagtggcagatgagctcctatgcgggtgacaacatc
atcacggcccaggccatgtacaaggggctgtggatggactgcgtcacgcagagcacgggg
atgatgagctgcaaaatgtacgactcggtgctcgccctgtccgcggccttgcaggccact
cgagccctaatggtggtctccctggtgctgggcttcctggccatgtttgtggccacgatg
ggcatgaagtgcacgcgctgtgggggagacgacaaagtgaagaaggcccgtatagccatg
ggtggaggcataattttcatcgtggcaggtcttgccgccttggtagcttgctcctggtat
ggccatcagattgtcacagacttttataaccctttgatccctaccaacattaagtatgag
tttggccctgccatctttattggctgggcagggtctgccctagtcatcctgggaggtgca
ctgctctcctgttcctgtcctgggaatgagagcaaggctgggtaccgtgtaccccgctct
taccctaagtccaactcttccaaggagtatgtgtga

KEGG   Homo sapiens (human): 137075Help
Entry
137075            CDS       T01001                                 

Gene name
CLDN23, CLDNL, hCG1646163
Definition
(RefSeq) claudin 23
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    137075 (CLDN23)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    137075 (CLDN23)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    137075 (CLDN23)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    137075 (CLDN23)
  09172 Infectious disease: viral
   05160 Hepatitis C
    137075 (CLDN23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    137075 (CLDN23)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   137075 (CLDN23)
  Exosomal proteins of colorectal cancer cells
   137075 (CLDN23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF1282 L_HMGIC_fpl DUF872
Motif
Other DBs
NCBI-GeneID: 137075
NCBI-ProteinID: NP_919260
OMIM: 609203
HGNC: 17591
Ensembl: ENSG00000253958
Vega: OTTHUMG00000163674
Pharos: Q96B33(Tbio)
UniProt: Q96B33
LinkDB All DBs
Position
8p23.1
AA seq 292 aa AA seqDB search
MRTPVVMTLGMVLAPCGLLLNLTGTLAPGWRLVKGFLNQPVDVELYQGLWDMCREQSSRE
RECGQTDQWGYFEAQPVLVARALMVTSLAATVLGLLLASLGVRCWQDEPNFVLAGLSGVV
LFVAGLLGLIPVSWYNHFLGDRDVLPAPASPVTVQVSYSLVLGYLGSCLLLLGGFSLALS
FAPWCDERCRRRRKGPSAGPRRSSVSTIQVEWPEPDLAPAIKYYSDGQHRPPPAQHRKPK
PKPKVGFPMPRPRPKAYTNSVDVLDGEGWESQDAPSCSTHPCDSSLPCDSDL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcggacgccggtggtgatgacgctgggcatggtgttggcgccctgcgggctcctgctc
aacctgaccggcaccctggcgcccggctggcggctggtgaagggcttcctgaaccagcca
gtggacgtggagttgtaccagggcctgtgggacatgtgtcgcgagcagagcagccgcgag
cgcgagtgcggccagacggaccagtggggctacttcgaggcccagcccgtgctggtggcg
cgggcactcatggtcacctcgctggccgccacggtcctggggcttctgctggcgtcgctg
ggcgtgcgctgctggcaggacgagcccaacttcgtgctggcagggctctcgggcgtcgtg
ctcttcgtcgctggcctcctcggcctcatcccggtgtcctggtacaaccacttcttgggg
gaccgcgacgtgctgcccgccccggccagcccggtcacggtgcaggtcagctacagcctg
gtcctgggctacctgggcagctgcctcctgctgctgggcggcttctcgctggcgctcagc
ttcgcgccctggtgcgacgagcgttgtcgccgccgccgcaagggaccctccgccgggcct
cgccgcagcagcgtcagcaccatccaagtggagtggcccgagcccgacctggcgcccgcc
atcaagtactacagcgacggccagcaccgaccgccgcctgcccagcaccgcaagcccaag
cccaagcccaaggtcggcttccccatgccgcggccgcggcccaaggcctacaccaactcg
gtggacgtcctcgacggggaggggtgggagtcccaggacgctccctcgtgcagcacccac
ccctgcgacagctcgctgccctgcgactccgacctctag

KEGG   Homo sapiens (human): 149461Help
Entry
149461            CDS       T01001                                 

Gene name
CLDN19, HOMG5
Definition
(RefSeq) claudin 19
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Disease
H01210  Hypomagnesemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    149461 (CLDN19)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    149461 (CLDN19)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    149461 (CLDN19)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    149461 (CLDN19)
  09172 Infectious disease: viral
   05160 Hepatitis C
    149461 (CLDN19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    149461 (CLDN19)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   149461 (CLDN19)
  Exosomal proteins of colorectal cancer cells
   149461 (CLDN19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin Mntp SUR7
Motif
Other DBs
NCBI-GeneID: 149461
NCBI-ProteinID: NP_683763
OMIM: 610036
HGNC: 2040
Ensembl: ENSG00000164007
Vega: OTTHUMG00000007524
Pharos: Q8N6F1(Tbio)
UniProt: Q8N6F1
LinkDB All DBs
Position
1p34.2
AA seq 224 aa AA seqDB search
MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTG
QVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRVAI
AGGALFILAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAVLGGS
FLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggccaactcaggcctccagctcctgggctacttcttggccctgggtggctgggtgggc
atcattgctagcacagccctgccacagtggaagcagtcttcctacgcaggcgacgccatc
atcactgccgtgggcctctatgaagggctctggatgtcctgcgcctcccagagcactggg
caagtgcagtgcaagctctacgactcgctgctcgccctggacggtcacatccaatcagcg
cgggccctgatggtggtggccgtgctcctgggcttcgtggccatggtcctcagcgtagtt
ggcatgaagtgtacgcgggtgggagacagcaaccccattgccaagggccgtgttgccatc
gccgggggagccctcttcatcctggcaggcctctgcactttgactgctgtctcgtggtat
gccaccctggtgacccaggagttcttcaacccaagcacacctgtcaatgccaggtatgaa
tttggcccagccctgttcgtgggctgggcctcagctggcctggccgtgctgggcggctcc
ttcctctgctgcacatgcccggagccagagagacccaacagcagcccacagccctatcgg
cctggaccctctgctgctgcccgagaaccagttgttaaattgcccgcctccgccaagggc
cccctgggtgtgtaa

KEGG   Homo sapiens (human): 23562Help
Entry
23562             CDS       T01001                                 

Gene name
CLDN14, DFNB29
Definition
(RefSeq) claudin 14
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Disease
H00605  Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    23562 (CLDN14)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    23562 (CLDN14)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    23562 (CLDN14)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    23562 (CLDN14)
  09172 Infectious disease: viral
   05160 Hepatitis C
    23562 (CLDN14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    23562 (CLDN14)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   23562 (CLDN14)
  Exosomal proteins of colorectal cancer cells
   23562 (CLDN14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin Laminin_EGF
Motif
Other DBs
NCBI-GeneID: 23562
NCBI-ProteinID: NP_001139549
OMIM: 605608
HGNC: 2035
Ensembl: ENSG00000159261
Vega: OTTHUMG00000086638
Pharos: O95500(Tbio)
UniProt: O95500
LinkDB All DBs
Position
21q22.13
AA seq 239 aa AA seqDB search
MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTG
IYQCQIYRSLLALPQDLQAARALMVISCLLSGIACACAVIGMKCTRCAKGTPAKTTFAIL
GGTLFILAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTL
LCLSCQDEAPYRPYQAPPRATTTTANTAPAYQPPAAYKDNRAPSVTSATHSGYRLNDYV
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggccagcacggccgtgcagcttctgggcttcctgctcagcttcctgggcatggtgggc
acgttgatcaccaccatcctgccgcactggcggaggacagcgcacgtgggcaccaacatc
ctcacggccgtgtcctacctgaaagggctctggatggagtgtgtgtggcacagcacaggc
atctaccagtgccagatctaccgatccctgctggcgctgccccaagacctccaggctgcc
cgcgccctcatggtcatctcctgcctgctctcgggcatagcctgcgcctgcgccgtcatc
gggatgaagtgcacgcgctgcgccaagggcacacccgccaagaccacctttgccatcctc
ggcggcaccctcttcatcctggccggcctcctgtgcatggtggccgtctcctggaccacc
aacgacgtggtgcagaacttctacaacccgctgctgcccagcggcatgaagtttgagatt
ggccaggccctgtacctgggcttcatctcctcgtccctctcgctcattggtggcaccctg
ctttgcctgtcctgccaggacgaggcaccctacaggccctaccaggccccgcccagggcc
accacgaccactgcaaacaccgcacctgcctaccagccaccagctgcctacaaagacaat
cgggccccctcagtgacctcggccacgcacagcgggtacaggctgaacgactacgtgtga

KEGG   Homo sapiens (human): 24146Help
Entry
24146             CDS       T01001                                 

Gene name
CLDN15
Definition
(RefSeq) claudin 15
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    24146 (CLDN15)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    24146 (CLDN15)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    24146 (CLDN15)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    24146 (CLDN15)
  09172 Infectious disease: viral
   05160 Hepatitis C
    24146 (CLDN15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    24146 (CLDN15)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   24146 (CLDN15)
  Exosomal proteins of colorectal cancer cells
   24146 (CLDN15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 24146
NCBI-ProteinID: NP_001172009
OMIM: 615778
HGNC: 2036
Ensembl: ENSG00000106404
Vega: OTTHUMG00000150512
Pharos: P56746(Tbio)
UniProt: P56746
LinkDB All DBs
Position
7q22.1
AA seq 228 aa AA seqDB search
MSMAVETFGFFMATVGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWFSCATDSLGVY
NCWEFPSMLALSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA
GALHILAGICGMVAISWYAFNITRDFFDPLYPGTKYELGPALYLGWSASLISILGGLCLC
SACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatggctgtggaaacctttggcttcttcatggcaactgtggggctgctgatgctg
ggggtgactctgccaaacagctactggcgagtgtccactgtgcacgggaacgtcatcacc
accaacaccatcttcgagaacctctggtttagctgtgccaccgactccctgggcgtctac
aactgctgggagttcccgtccatgctggccctctctgggtatattcaggcctgccgggca
ctcatgatcaccgccatcctcctgggcttcctcggcctcttgctaggcatagcgggcctg
cgctgcaccaacattgggggcctggagctctccaggaaagccaagctggcggccaccgca
ggggccctccacattctggccggtatctgcgggatggtggccatctcctggtacgccttc
aacatcacccgggacttcttcgaccccttgtaccccggaaccaagtacgagctgggcccc
gccctctacctggggtggagcgcctcactgatctccatcctgggtggcctctgcctctgc
tccgcctgctgctgcggctctgacgaggacccagccgccagcgcccggcggccctaccag
gctccagtgtccgtgatgcccgtcgccacctcggaccaagaaggcgacagcagctttggc
aaatacggcagaaacgcctacgtgtag

KEGG   Homo sapiens (human): 26285Help
Entry
26285             CDS       T01001                                 

Gene name
CLDN17
Definition
(RefSeq) claudin 17
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    26285 (CLDN17)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    26285 (CLDN17)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    26285 (CLDN17)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    26285 (CLDN17)
  09172 Infectious disease: viral
   05160 Hepatitis C
    26285 (CLDN17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    26285 (CLDN17)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   26285 (CLDN17)
  Exosomal proteins of colorectal cancer cells
   26285 (CLDN17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF4064 Clc-like Jiraiya Claudin_3
Motif
Other DBs
NCBI-GeneID: 26285
NCBI-ProteinID: NP_036263
OMIM: 617005
HGNC: 2038
Ensembl: ENSG00000156282
Vega: OTTHUMG00000081873
Pharos: P56750(Tdark)
UniProt: P56750
LinkDB All DBs
Position
21q21.3
AA seq 224 aa AA seqDB search
MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIRQARV
RLQCKFYSSLLALPPALETARALMCVAVALSLIALLIGICGMKQVQCTGSNERAKAYLLG
TSGVLFILTGIFVLIPVSWTANIIIRDFYNPAIHIGQKRELGAALFLGWASAAVLFIGGG
LLCGFCCCNRKKQGYRYPVPGYRVPHTDKRRNTTMLSKTSTSYV
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcattttatcccttgcaaattgctgggctggttcttgggttccttggcatggtgggg
actcttgccacaacccttctgcctcagtggagagtatcagcttttgttggcagcaacatt
attgtctttgagaggctctgggaagggctctggatgaattgcatccgacaagccagggtc
cggttgcaatgcaagttctatagctccttgttggctctcccgcctgccctggaaacagcc
cgggccctcatgtgtgtggctgttgctctctccttgatcgccctgcttattggcatctgt
ggcatgaagcaggtccagtgcacaggctctaacgagagggccaaagcataccttctggga
acttcaggagtcctcttcatcctgacgggcatcttcgttctgattccggtgagctggaca
gccaatataatcatcagagatttctacaacccagccatccacataggtcagaaacgagag
ctgggagcagcacttttccttggctgggcaagcgctgctgtcctcttcattggagggggt
ctgctttgtggattttgctgctgcaacagaaagaagcaagggtacagatatccagtgcct
ggctaccgtgtgccacacacagataagcgaagaaatacgacaatgcttagtaagacctcc
accagttatgtctaa

KEGG   Homo sapiens (human): 49861Help
Entry
49861             CDS       T01001                                 

Gene name
CLDN20
Definition
(RefSeq) claudin 20
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    49861 (CLDN20)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    49861 (CLDN20)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    49861 (CLDN20)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    49861 (CLDN20)
  09172 Infectious disease: viral
   05160 Hepatitis C
    49861 (CLDN20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    49861 (CLDN20)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   49861 (CLDN20)
  Exosomal proteins of colorectal cancer cells
   49861 (CLDN20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like DUF981
Motif
Other DBs
NCBI-GeneID: 49861
NCBI-ProteinID: NP_001001346
HGNC: 2042
Ensembl: ENSG00000171217
Vega: OTTHUMG00000015882
Pharos: P56880(Tdark)
UniProt: P56880 A0A140VKA2
LinkDB All DBs
Position
6q25.3
AA seq 219 aa AA seqDB search
MASAGLQLLAFILALSGVSGVLTATLLPNWKVNVDVDSNIITAIVQLHGLWMDCTWYSTG
MFSCALKHSILSLPIHVQAARATMVLACVLSALGICTSTVGMKCTRLGGDRETKSHASFA
GGVCFMSAGISSLISTVWYTKEIIANFLDLTVPESNKHEPGGAIYIGFISAMLLFISGMI
FCTSCIKRNPEARLDPPTQQPISNTQLENNSTHNLKDYV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcctcagcaggactccagctccttgctttcatcctggccttatctggggtctctgga
gtgctcacagccactctgctgcccaactggaaggtgaatgtggatgtggactccaacatc
ataacagccattgtacagctgcacgggctctggatggactgtacgtggtacagcactggg
atgttcagctgtgccctgaaacactccattctgtccctccccatccacgtgcaggctgcg
agagccaccatggtcctggcgtgtgttctgtctgctttggggatctgcacttccacagta
ggaatgaaatgtactcgcttaggaggggacagagaaaccaagagccatgcttcctttgct
ggaggagtctgtttcatgtctgcaggaatctctagtttaatctcgacagtgtggtacaca
aaggagatcatagcaaactttctggatctgacagttccagaaagcaacaaacatgaacct
ggaggagctatctatatcggattcatttctgcaatgctgttgtttatctctggcatgatt
ttctgcacctcctgtataaaaaggaatccagaagctagactcgacccacccacacagcag
cctatctctaacacacagctcgagaacaattccacacacaatctgaaggattatgtgtaa

KEGG   Homo sapiens (human): 5010Help
Entry
5010              CDS       T01001                                 

Gene name
CLDN11, OSP, OTM
Definition
(RefSeq) claudin 11
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    5010 (CLDN11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5010 (CLDN11)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    5010 (CLDN11)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    5010 (CLDN11)
  09172 Infectious disease: viral
   05160 Hepatitis C
    5010 (CLDN11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5010 (CLDN11)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   5010 (CLDN11)
  Exosomal proteins of colorectal cancer cells
   5010 (CLDN11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF3273
Motif
Other DBs
NCBI-GeneID: 5010
NCBI-ProteinID: NP_005593
OMIM: 601326
HGNC: 8514
Ensembl: ENSG00000013297
Vega: OTTHUMG00000158940
Pharos: O75508(Tbio)
UniProt: O75508
LinkDB All DBs
Position
3q26.2
AA seq 207 aa AA seqDB search
MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMAT
GLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRA
QLAGVLLILLALCALVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAG
DAQAFGENRFYYTAGSSSPTHAKSAHV
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggtggccacgtgcctgcaggtggtgggcttcgtcacgagcttcgtgggctggatcggg
gtcatcgtgaccacctccaccaatgactgggtggtgacctgcggctacaccatccccacc
tgccgcaagctggatgagctgggctccaaggggctgtgggccgactgcgtcatggccacg
gggctgtaccactgcaagcccctggtggacatcctcatcctgccgggctacgtgcaggcc
tgccgcgccctgatgattgctgcctcggtcctgggtctgccggccattttactgctgctg
actgttcttccctgcatccggatgggccaggagcccggtgtggctaagtacaggcgggcc
cagctggctggtgttttgctcattctgctggctctctgcgcccttgttgccaccatctgg
ttccctgtgtgcgcccaccgtgagaccaccatcgtgagctttggctactccctgtatgca
ggctggattggtgctgtgctgtgcctcgtgggtggctgtgtcatcctctgctgcgctgga
gatgcccaggcctttggtgaaaaccgtttctactacactgcgggctctagctccccgact
catgcgaagagtgcccacgtataa

KEGG   Homo sapiens (human): 51208Help
Entry
51208             CDS       T01001                                 

Gene name
CLDN18, SFTA5, SFTPJ
Definition
(RefSeq) claudin 18
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Drug target
Zolbetuximab: D11527
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    51208 (CLDN18)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    51208 (CLDN18)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    51208 (CLDN18)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    51208 (CLDN18)
  09172 Infectious disease: viral
   05160 Hepatitis C
    51208 (CLDN18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    51208 (CLDN18)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   51208 (CLDN18)
  Exosomal proteins of colorectal cancer cells
   51208 (CLDN18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 51208
NCBI-ProteinID: NP_001002026
OMIM: 609210
HGNC: 2039
Ensembl: ENSG00000066405
Vega: OTTHUMG00000159762
Pharos: P56856(Tbio)
UniProt: P56856
LinkDB All DBs
Position
3q22.3
AA seq 261 aa AA seqDB search
MAVTACQGLGFVVSLIGIAGIIAATCMDQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGF
TECRGYFTLLGLPAMLQAVRALMIVGIVLGAIGLLVSIFALKCIRIGSMEDSAKANMTLT
SGIMFIVSGLCAIAGVSVFANMLVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWV
AGGLTLIGGVMMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKI
YDGGARTEDEVQSYPSKHDYV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgactgcctgtcagggcttggggttcgtggtttcactgattgggattgcgggc
atcattgctgccacctgcatggaccagtggagcacccaagacttgtacaacaaccccgta
acagctgttttcaactaccaggggctgtggcgctcctgtgtccgagagagctctggcttc
accgagtgccggggctacttcaccctgctggggctgccagccatgctgcaggcagtgcga
gccctgatgatcgtaggcatcgtcctgggtgccattggcctcctggtatccatctttgcc
ctgaaatgcatccgcattggcagcatggaggactctgccaaagccaacatgacactgacc
tccgggatcatgttcattgtctcaggtctttgtgcaattgctggagtgtctgtgtttgcc
aacatgctggtgactaacttctggatgtccacagctaacatgtacaccggcatgggtggg
atggtgcagactgttcagaccaggtacacatttggtgcggctctgttcgtgggctgggtc
gctggaggcctcacactaattgggggtgtgatgatgtgcatcgcctgccggggcctggca
ccagaagaaaccaactacaaagccgtttcttatcatgcctcaggccacagtgttgcctac
aagcctggaggcttcaaggccagcactggctttgggtccaacaccaaaaacaagaagata
tacgatggaggtgcccgcacagaggacgaggtacaatcttatccttccaagcacgactat
gtgtaa

KEGG   Homo sapiens (human): 53842Help
Entry
53842             CDS       T01001                                 

Gene name
CLDN22, CLDN21
Definition
(RefSeq) claudin 22
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    53842 (CLDN22)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    53842 (CLDN22)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    53842 (CLDN22)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    53842 (CLDN22)
  09172 Infectious disease: viral
   05160 Hepatitis C
    53842 (CLDN22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    53842 (CLDN22)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   53842 (CLDN22)
  Exosomal proteins of colorectal cancer cells
   53842 (CLDN22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 53842
NCBI-ProteinID: NP_001104789
HGNC: 2044
Ensembl: ENSG00000177300
Vega: OTTHUMG00000160627
Pharos: Q8N7P3(Tdark)
UniProt: Q8N7P3
LinkDB All DBs
Position
4q35.1
AA seq 220 aa AA seqDB search
MALVFRTVAQLAGVSLSLLGWVLSCLTNYLPHWKNLNLDLNEMENWTMGLWQTCVIQEEV
GMQCKDFDSFLALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRIGESQRDLKRRLLI
LGGILSWASGVTALVPVSWVAHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGG
CLLHCAACSSHAPLASGHYAVAQTQDHHQELETRNTNLKH
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggctttagtatttagaactgtagctcaactagctggagtttcattatctttgctggga
tgggttttatcctgtcttacaaactacctgccacactggaagaacctcaacctggactta
aatgaaatggaaaactggaccatgggactctggcaaacctgtgtcatccaagaggaagtg
gggatgcaatgcaaggactttgactccttcctggctttgcctgctgaactcagggtctcc
aggatcttaatgtttctgtcaaatgggctgggatttctgggcctgctggtctctgggttt
ggcctggactgtttgagaattggagagagtcagagagatctcaagaggcgactgctgatc
ctgggaggaattctgtcctgggcctcgggagtcacagccctggttcccgtctcttgggtt
gcccacaagacggttcaggagttctgggatgagaacgtcccagactttgtccccaggtgg
gagtttggggaggccctgtttctgggctggtttgctggactttctcttctgctaggaggg
tgtctgctccactgtgcagcctgctccagccacgctcccctagcttcgggccactacgca
gtggcacaaacacaagatcatcatcaagaactggagacgagaaacaccaacctgaaacac
taa

KEGG   Homo sapiens (human): 644672Help
Entry
644672            CDS       T01001                                 

Gene name
CLDN25
Definition
(RefSeq) claudin 25
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    644672 (CLDN25)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    644672 (CLDN25)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    644672 (CLDN25)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    644672 (CLDN25)
  09172 Infectious disease: viral
   05160 Hepatitis C
    644672 (CLDN25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    644672 (CLDN25)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   644672 (CLDN25)
  Exosomal proteins of colorectal cancer cells
   644672 (CLDN25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 644672
NCBI-ProteinID: NP_001094859
HGNC: 37218
Ensembl: ENSG00000228607
Vega: OTTHUMG00000168193
Pharos: C9JDP6(Tdark)
UniProt: C9JDP6
LinkDB All DBs
Position
11q23.2
AA seq 229 aa AA seqDB search
MAWSFRAKVQLGGLLLSLLGWVCSCVTTILPQWKTLNLELNEMETWIMGIWEVCVDREEV
ATVCKAFESFLSLPQELQVARILMVASHGLGLLGLLLCSFGSECFQFHRIRWVFKRRLGL
LGRTLEASASATTLLPVSWVAHATIQDFWDDSIPDIIPRWEFGGALYLGWAAGIFLALGG
LLLIFSACLGKEDVPFPLMAGPTVPLSCAPVEESDGSFHLMLRPRNLVI
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggcctggagtttccgtgcaaaagtccagctcggggggctacttctctccctccttggc
tgggtctgctcctgtgttaccaccatcctgccccagtggaagactcttaatctggaactg
aacgagatggagacctggatcatggggatttgggaggtctgcgtggatcgagaggaagtc
gccactgtgtgcaaggcctttgaatccttcttgtctctgccccaggagctccaggtagcc
cgcatcctcatggtagcctcccatgggctgggcctattggggcttttgctctgcagcttt
gggtctgaatgcttccagtttcacaggatcagatgggtattcaagaggcggcttggtctc
ctgggaaggactttggaggcatccgcttcagccactaccctccttccagtctcctgggtg
gcccatgccacaatccaagacttctgggatgacagcatccctgacatcatacctcggtgg
gagtttggaggtgccctctacttgggctgggctgctggtattttcctggctcttggtggg
ctactcctcatcttctcggcctgcctgggaaaagaagatgtgccttttcctttgatggct
ggtcccacagtccccctatcctgtgctccagtggaggagtcagatggctccttccacctc
atgctaagacctaggaacctggtcatctag

KEGG   Homo sapiens (human): 7122Help
Entry
7122              CDS       T01001                                 

Gene name
CLDN5, AWAL, BEC1, CPETRL1, TMDVCF, TMVCF
Definition
(RefSeq) claudin 5
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    7122 (CLDN5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    7122 (CLDN5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    7122 (CLDN5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    7122 (CLDN5)
  09172 Infectious disease: viral
   05160 Hepatitis C
    7122 (CLDN5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7122 (CLDN5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   7122 (CLDN5)
  Exosomal proteins of colorectal cancer cells
   7122 (CLDN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like
Motif
Other DBs
NCBI-GeneID: 7122
NCBI-ProteinID: NP_001124333
OMIM: 602101
HGNC: 2047
Ensembl: ENSG00000184113
Vega: OTTHUMG00000150441
Pharos: O00501(Tbio)
UniProt: O00501 D3DX19
LinkDB All DBs
Position
22q11.21
AA seq 303 aa AA seqDB search
MTRARIGCFGPGGRARGTESAPEPSKRVPPGRSWQTQEVRQTRGANGLGPRAGSAGAKAP
GPAQGAAQHGLGGSAGLRVRVSPLAMGSAALEILGLVLCLVGWGGLILACGLPMWQVTAF
LDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVSAVLLAFVAL
FVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVS
QKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKK
NYV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgcacggattggctgcttcgggccggggggccgggcccgggggacagaatcc
gcccccgaaccttcaaagagggtaccccccggcaggagctggcagacccaggaggtgcga
cagacccgcggggcaaacggactggggccaagagccgggagcgcgggcgcaaaggcacca
gggcccgcccagggcgccgcgcagcacggccttgggggttctgcgggccttcgggtgcgc
gtctcgcctctagccatggggtccgcagcgttggagatcctgggcctggtgctgtgcctg
gtgggctgggggggtctgatcctggcgtgcgggctgcccatgtggcaggtgaccgccttc
ctggaccacaacatcgtgacggcgcagaccacctggaaggggctgtggatgtcgtgcgtg
gtgcagagcaccgggcacatgcagtgcaaagtgtacgactcggtgctggctctgagcacc
gaggtgcaggcggcgcgggcgctcaccgtgagcgccgtgctgctggcgttcgttgcgctc
ttcgtgaccctggcgggcgcgcagtgcaccacctgcgtggccccgggcccggccaaggcg
cgtgtggccctcacgggaggcgtgctctacctgttttgcgggctgctggcgctcgtgcca
ctctgctggttcgccaacattgtcgtccgcgagttttacgacccgtctgtgcccgtgtcg
cagaagtacgagctgggcgcagcgctgtacatcggctgggcggccaccgcgctgctcatg
gtaggcggctgcctcttgtgctgcggcgcctgggtctgcaccggccgtcccgacctcagc
ttccccgtgaagtactcagcgccgcggcggcccacggccaccggcgactacgacaagaag
aactacgtctga

KEGG   Homo sapiens (human): 9071Help
Entry
9071              CDS       T01001                                 

Gene name
CLDN10, CPETRL3, HELIX, OSP-L, OSPL
Definition
(RefSeq) claudin 10
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    9071 (CLDN10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    9071 (CLDN10)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    9071 (CLDN10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    9071 (CLDN10)
  09172 Infectious disease: viral
   05160 Hepatitis C
    9071 (CLDN10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    9071 (CLDN10)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   9071 (CLDN10)
  Exosomal proteins of colorectal cancer cells
   9071 (CLDN10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 9071
NCBI-ProteinID: NP_008915
OMIM: 617579
HGNC: 2033
Ensembl: ENSG00000134873
Vega: OTTHUMG00000017217
Pharos: P78369(Tbio)
UniProt: P78369
LinkDB All DBs
Position
13q32.1
AA seq 228 aa AA seqDB search
MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGV
SNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLA
GIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFC
FSISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggctagcacggcttcggagatcatcgccttcatggtctccatctcaggctgggtactg
gtgtcctccacgctgcccaccgactactggaaggtgtctaccatcgacggcacggtcatc
acaaccgccacctattgggccaacctgtggaaggcgtgcgttaccgactccacgggcgtc
tccaactgcaaggacttcccctccatgctggcgctggacggttatatacaggcatgtaga
ggacttatgatcgctgctgtcagcctgggcttctttggttccatatttgcgctctttgga
atgaagtgtaccaaagtcggaggctccgataaagccaaagctaaaattgcttgtttggct
gggattgtattcatactgtcagggctgtgctcaatgactggatgttccctatatgcaaac
aaaatcacaacggaattctttgatcctctctttgttgagcaaaagtatgaattaggagcc
gctctgtttattggatgggcaggagcctcactgtgcataattggtggtgtcatattttgc
ttttcaatatctgacaacaacaaaacacccagatacacatacaacggggccacatctgtc
atgtcttctcggacaaagtatcatggtggagaagattttaaaacaacaaacccttcaaaa
cagtttgataaaaatgcttatgtctaa

KEGG   Homo sapiens (human): 9073Help
Entry
9073              CDS       T01001                                 

Gene name
CLDN8, HEL-S-79
Definition
(RefSeq) claudin 8
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    9073 (CLDN8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    9073 (CLDN8)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    9073 (CLDN8)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    9073 (CLDN8)
  09172 Infectious disease: viral
   05160 Hepatitis C
    9073 (CLDN8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    9073 (CLDN8)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   9073 (CLDN8)
  Exosomal proteins of colorectal cancer cells
   9073 (CLDN8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 YccF
Motif
Other DBs
NCBI-GeneID: 9073
NCBI-ProteinID: NP_955360
OMIM: 611231
HGNC: 2050
Ensembl: ENSG00000156284
Vega: OTTHUMG00000081872
Pharos: P56748(Tbio)
UniProt: P56748 A0A0K0K1I9
LinkDB All DBs
Position
21q22.11
AA seq 225 aa AA seqDB search
MATHALEIAGLFLGGVGMVGTVAVTVMPQWRVSAFIENNIVVFENFWEGLWMNCVRQANI
RMQCKIYDSLLALSPDLQAARGLMCAASVMSFLAFMMAILGMKCTRCTGDNEKVKAHILL
TAGIIFIITGMVVLIPVSWVANAIIRDFYNSIVNVAQKRELGEALYLGWTTALVLIVGGA
LFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcaacccatgccttagaaatcgctgggctgtttcttggtggtgttggaatggtgggc
acagtggctgtcactgtcatgcctcagtggagagtgtcggccttcattgaaaacaacatc
gtggtttttgaaaacttctgggaaggactgtggatgaattgcgtgaggcaggctaacatc
aggatgcagtgcaaaatctatgattccctgctggctctttctccggacctacaggcagcc
agaggactgatgtgtgctgcttccgtgatgtccttcttggctttcatgatggccatcctt
ggcatgaaatgcaccaggtgcacgggggacaatgagaaggtgaaggctcacattctgctg
acggctggaatcatcttcatcatcacgggcatggtggtgctcatccctgtgagctgggtt
gccaatgccatcatcagagatttctataactcaatagtgaatgttgcccaaaaacgtgag
cttggagaagctctctacttaggatggaccacggcactggtgctgattgttggaggagct
ctgttctgctgcgttttttgttgcaacgaaaagagcagtagctacagatactcgatacct
tcccatcgcacaacccaaaaaagttatcacaccggaaagaagtcaccgagcgtctactcc
agaagtcagtatgtgtag

KEGG   Homo sapiens (human): 9074Help
Entry
9074              CDS       T01001                                 

Gene name
CLDN6
Definition
(RefSeq) claudin 6
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    9074 (CLDN6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    9074 (CLDN6)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    9074 (CLDN6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    9074 (CLDN6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    9074 (CLDN6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    9074 (CLDN6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   9074 (CLDN6)
  Exosomal proteins of colorectal cancer cells
   9074 (CLDN6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 TMEM37
Motif
Other DBs
NCBI-GeneID: 9074
NCBI-ProteinID: NP_067018
OMIM: 615798
HGNC: 2048
Ensembl: ENSG00000184697
Vega: OTTHUMG00000128999
Pharos: P56747(Tbio)
UniProt: P56747
LinkDB All DBs
Position
16p13.3
AA seq 220 aa AA seqDB search
MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTG
QMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLT
SGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGL
LCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcctctgccggaatgcagatcctgggagtcgtcctgacactgctgggctgggtgaat
ggcctggtctcctgtgccctgcccatgtggaaggtgaccgctttcatcggcaacagcatc
gtggtggcccaggtggtgtgggagggcctgtggatgtcctgcgtggtgcagagcaccggc
cagatgcagtgcaaggtgtacgactcactgctggcgctgccacaggacctgcaggctgca
cgtgccctctgtgtcatcgccctccttgtggccctgttcggcttgctggtctaccttgct
ggggccaagtgtaccacctgtgtggaggagaaggattccaaggcccgcctggtgctcacc
tctgggattgtctttgtcatctcaggggtcctgacgctaatccccgtgtgctggacggcg
catgccatcatccgggacttctataaccccctggtggctgaggcccaaaagcgggagctg
ggggcctccctctacttgggctgggcggcctcaggccttttgttgctgggtggggggttg
ctgtgctgcacttgcccctcgggggggtcccagggccccagccattacatggcccgctac
tcaacatctgcccctgccatctctcgggggccctctgagtaccctaccaagaattacgtc
tga

KEGG   Homo sapiens (human): 9075Help
Entry
9075              CDS       T01001                                 

Gene name
CLDN2
Definition
(RefSeq) claudin 2
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    9075 (CLDN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    9075 (CLDN2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    9075 (CLDN2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    9075 (CLDN2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    9075 (CLDN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    9075 (CLDN2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   9075 (CLDN2)
  Exosomal proteins of colorectal cancer cells
   9075 (CLDN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF4064 Clc-like Amastin DUF973
Motif
Other DBs
NCBI-GeneID: 9075
NCBI-ProteinID: NP_001164563
OMIM: 300520
HGNC: 2041
Ensembl: ENSG00000165376
Vega: OTTHUMG00000022154
Pharos: P57739(Tbio)
UniProt: P57739
LinkDB All DBs
Position
Xq22.3
AA seq 230 aa AA seqDB search
MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTG
ITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVA
GGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGII
LCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcctctcttggcctccaacttgtgggctacatcctaggccttctggggcttttgggc
acactggttgccatgctgctccccagctggaaaacaagttcttatgtcggtgccagcatt
gtgacagcagttggcttctccaagggcctctggatggaatgtgccacacacagcacaggc
atcacccagtgtgacatctatagcacccttctgggcctgcccgctgacatccaggctgcc
caggccatgatggtgacatccagtgcaatctcctccctggcctgcattatctctgtggtg
ggcatgagatgcacagtcttctgccaggaatcccgagccaaagacagagtggcggtagca
ggtggagtctttttcatccttggaggcctcctgggattcattcctgttgcctggaatctt
catgggatcctacgggacttctactcaccactggtgcctgacagcatgaaatttgagatt
ggagaggctctttacttgggcattatttcttccctgttctccctgatagctggaatcatc
ctctgcttttcctgctcatcccagagaaatcgctccaactactacgatgcctaccaagcc
caacctcttgccacaaggagctctccaaggcctggtcaacctcccaaagtcaagagtgag
ttcaattcctacagcctgacagggtatgtgtga

KEGG   Homo sapiens (human): 9076Help
Entry
9076              CDS       T01001                                 

Gene name
CLDN1, CLD1, ILVASC, SEMP1
Definition
(RefSeq) claudin 1
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Disease
H00742  Neonatal ichthyosis-sclerosing cholangitis (NISCH) syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    9076 (CLDN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    9076 (CLDN1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    9076 (CLDN1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    9076 (CLDN1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    9076 (CLDN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    9076 (CLDN1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   9076 (CLDN1)
  Exosomal proteins of colorectal cancer cells
   9076 (CLDN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF2613 Amastin SUR7 Cytochrom_B_C YccF DUF4064
Motif
Other DBs
NCBI-GeneID: 9076
NCBI-ProteinID: NP_066924
OMIM: 603718
HGNC: 2032
Ensembl: ENSG00000163347
Vega: OTTHUMG00000156214
Pharos: O95832(Tbio)
UniProt: O95832 A5JSJ9
LinkDB All DBs
Position
3q28
AA seq 211 aa AA seqDB search
MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGLWMSCVSQSTG
QIQCKVFDSLLNLSSTLQATRALMVVGILLGVIAIFVATVGMKCMKCLEDDEVQKMRMAV
IGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGA
LLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgcggggctgcagctgttgggcttcattctcgccttcctgggatggatcggc
gccatcgtcagcactgccctgccccagtggaggatttactcctatgccggcgacaacatc
gtgaccgcccaggccatgtacgaggggctgtggatgtcctgcgtgtcgcagagcaccggg
cagatccagtgcaaagtctttgactccttgctgaatctgagcagcacattgcaagcaacc
cgtgccttgatggtggttggcatcctcctgggagtgatagcaatctttgtggccaccgtt
ggcatgaagtgtatgaagtgcttggaagacgatgaggtgcagaagatgaggatggctgtc
attgggggtgcgatatttcttcttgcaggtctggctattttagttgccacagcatggtat
ggcaatagaatcgttcaagaattctatgaccctatgaccccagtcaatgccaggtacgaa
tttggtcaggctctcttcactggctgggctgctgcttctctctgccttctgggaggtgcc
ctactttgctgttcctgtccccgaaaaacaacctcttacccaacaccaaggccctatcca
aaacctgcaccttccagcgggaaagactacgtgtga

KEGG   Homo sapiens (human): 9080Help
Entry
9080              CDS       T01001                                 

Gene name
CLDN9
Definition
(RefSeq) claudin 9
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    9080 (CLDN9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    9080 (CLDN9)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    9080 (CLDN9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    9080 (CLDN9)
  09172 Infectious disease: viral
   05160 Hepatitis C
    9080 (CLDN9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    9080 (CLDN9)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   9080 (CLDN9)
  Exosomal proteins of colorectal cancer cells
   9080 (CLDN9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF872 TMEM100
Motif
Other DBs
NCBI-GeneID: 9080
NCBI-ProteinID: NP_066192
OMIM: 615799
HGNC: 2051
Ensembl: ENSG00000213937
Vega: OTTHUMG00000129000
Pharos: O95484(Tbio)
UniProt: O95484
LinkDB All DBs
Structure
PDB: 

Position
16p13.3
AA seq 217 aa AA seqDB search
MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTG
QMQCKVYDSLLALPQDLQAARALCVIALLLALLGLLVAITGAQCTTCVEDEGAKARIVLT
AGVILLLAGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGL
LCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgaccggcttagaactgctgggcatgaccctggctgtgctgggctggctgggg
accctggtgtcctgcgccctgcccctgtggaaggtgaccgccttcatcggcaacagcatc
gtggtggcccaggtggtgtgggagggcctgtggatgtcctgcgtggtgcagagcacgggc
cagatgcagtgcaaggtgtacgactcactgctggctctgccgcaggacctgcaggccgca
cgtgccctctgtgtcattgccctcctgctggccctgcttggcctcctggtggccatcaca
ggtgcccagtgtaccacgtgtgtggaggacgaaggtgccaaggcccgtatcgtgctcacc
gcgggggtcatcctcctcctcgccggcatcctggtgctcatccctgtgtgctggacggcg
cacgccatcatccaggacttctacaaccccctggtggctgaggccctcaagcgggagctg
ggggcctccctctacctgggctgggcggcggctgcactgcttatgctgggcggggggctc
ctctgctgcacgtgccccccgccccaggtcgagcggccccgcggacctcggctgggctac
tccatcccctcccgctcgggtgcatctggactggacaagagggactacgtgtga

DBGET integrated database retrieval system