KEGG   Homo sapiens (human): 100137049
Entry
100137049         CDS       T01001                                 

Gene name
PLA2G4B, HsT16992, cPLA2-beta
Definition
(RefSeq) phospholipase A2 group IVB
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100137049 (PLA2G4B)
   00565 Ether lipid metabolism
    100137049 (PLA2G4B)
   00590 Arachidonic acid metabolism
    100137049 (PLA2G4B)
   00591 Linoleic acid metabolism
    100137049 (PLA2G4B)
   00592 alpha-Linolenic acid metabolism
    100137049 (PLA2G4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100137049 (PLA2G4B)
   04010 MAPK signaling pathway
    100137049 (PLA2G4B)
   04370 VEGF signaling pathway
    100137049 (PLA2G4B)
   04072 Phospholipase D signaling pathway
    100137049 (PLA2G4B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100137049 (PLA2G4B)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100137049 (PLA2G4B)
   04664 Fc epsilon RI signaling pathway
    100137049 (PLA2G4B)
   04666 Fc gamma R-mediated phagocytosis
    100137049 (PLA2G4B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100137049 (PLA2G4B)
   04913 Ovarian steroidogenesis
    100137049 (PLA2G4B)
   04921 Oxytocin signaling pathway
    100137049 (PLA2G4B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100137049 (PLA2G4B)
  09156 Nervous system
   04724 Glutamatergic synapse
    100137049 (PLA2G4B)
   04726 Serotonergic synapse
    100137049 (PLA2G4B)
   04730 Long-term depression
    100137049 (PLA2G4B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100137049 (PLA2G4B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100137049 (PLA2G4B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100137049 (PLA2G4B)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 100137049
NCBI-ProteinID: NP_001108105
OMIM: 606088
HGNC: 9036
Ensembl: ENSG00000243708
Vega: OTTHUMG00000156809
UniProt: P0C869
LinkDB
Position
15q15.1
AA seq 781 aa
MAVAEVSRTCLLTVRVLQAHRLPSKDLVTPSDCYVTLWLPTACSHRLQTRTVKNSSSPVW
NQSFHFRIHRQLKNVMELKVFDQDLVTGDDPVLSVLFDAGTLRAGEFRRESFSLSPQGEG
RLEVEFRLQSLADRGEWLVSNGVLVARELSCLHVQLEETGDQKSSEHRVQLVVPGSCEGP
QEASVGTGTFRFHCPACWEQELSIRLQDAPEEQLKAPLSALPSGQVVRLVFPTSQEPLMR
VELKKEAGLRELAVRLGFGPCAEEQAFLSRRKQVVAAALRQALQLDGDLQEDEIPVVAIM
ATGGGIRAMTSLYGQLAGLKELGLLDCVSYITGASGSTWALANLYEDPEWSQKDLAGPTE
LLKTQVTKNKLGVLAPSQLQRYRQELAERARLGYPSCFTNLWALINEALLHDEPHDHKLS
DQREALSHGQNPLPIYCALNTKGQSLTTFEFGEWCEFSPYEVGFPKYGAFIPSELFGSEF
FMGQLMKRLPESRICFLEGIWSNLYAANLQDSLYWASEPSQFWDRWVRNQANLDKEQVPL
LKIEEPPSTAGRIAEFFTDLLTWRPLAQATHNFLRGLHFHKDYFQHPHFSTWKATTLDGL
PNQLTPSEPHLCLLDVGYLINTSCLPLLQPTRDVDLILSLDYNLHGAFQQLQLLGRFCQE
QGIPFPPISPSPEEQLQPRECHTFSDPTCPGAPAVLHFPLVSDSFREYSAPGVRRTPEEA
AAGEVNLSSSDSPYHYTKVTYSQEDVDKLLHLTHYNVCNNQEQLLEALRQAVQRRRQRRP
H
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctgtggcagaggtgtccaggacctgcctgctcacggttcgtgtcctgcaggcccat
cgcctaccctctaaggacctagtgaccccctctgactgctacgtgactctctggctgccc
acggcctgcagccacaggctccagacacgcacggtcaagaacagcagtagccctgtctgg
aaccagagctttcacttcaggatccacaggcagctcaagaatgtcatggaactgaaagtc
tttgaccaggacctggtgaccggagatgaccctgtgttgtcagtactgtttgatgcgggg
actctgcgggctggggagttccggcgcgagagcttctcactgagccctcagggtgagggg
cgcctggaagttgaatttcgcctgcagagtctggctgaccgtggcgagtggctcgtcagc
aatggcgttctggtggcccgggagctctcctgcttgcacgttcaactggaggagacagga
gaccagaagtcctcagagcacagagttcagcttgtggttcctgggtcctgtgagggtccg
caggaggcctctgtgggcactggcaccttccgcttccactgcccagcctgctgggagcag
gagctgagtattcgcctgcaggatgcccccgaggagcaactaaaggcgccactgagtgcc
ctgccctctggtcaagtggtgaggcttgtcttccccacgtcccaggagcccctgatgaga
gtggagctgaaaaaagaagcaggactgagggagctggccgtgcgactgggcttcgggccc
tgtgcagaggagcaggccttcctgagcaggaggaagcaggtggtggccgcggccttgagg
caggccctgcagctggacggagacctgcaggaggatgagatcccagtggtagctattatg
gccactggtggtgggatccgggcaatgacttccctgtatgggcagctggctggcctgaag
gagctgggcctcttggattgcgtctcctacatcaccggggcctcgggctccacctgggcc
ttggccaacctttatgaggacccagagtggtctcagaaggacctggcagggcccactgag
ttgctgaagacccaggtgaccaagaacaagctgggtgtgctggcccccagccagctgcag
cggtaccggcaggagctggccgagcgtgcccgcttgggctacccaagctgcttcaccaac
ctgtgggccctcatcaacgaggcgctgctgcatgatgagccccatgatcacaagctctca
gatcaacgggaggccctgagtcatggccagaaccctctgcccatctactgtgccctcaac
accaaagggcagagcctgaccacttttgaatttggggagtggtgcgagttctctccctac
gaggtcggcttccccaagtacggggccttcatcccctctgagctctttggctccgagttc
tttatggggcagctgatgaagaggcttcctgagtcccgcatctgcttcttagaaggtatc
tggagcaacctgtatgcagccaacctccaggacagcttatactgggcctcagagcccagc
cagttctgggaccgctgggtcaggaaccaggccaacctggacaaggagcaggtccccctt
ctgaagatagaagaaccaccctcaacagccggcaggatagctgagtttttcaccgatctt
ctgacgtggcgtccactggcccaggccacacataatttcctgcgtggcctccatttccac
aaagactactttcagcatcctcacttctccacatggaaagctaccactctggatgggctc
cccaaccagctgacaccctcggagccccacctgtgcctgctggatgttggctacctcatc
aataccagctgcctgcccctcctgcagcccactcgggacgtggacctcatcctgtcattg
gactacaacctccacggagccttccagcagttgcagctcctgggccggttctgccaggag
caggggatcccgttcccacccatctcgcccagccccgaagagcagctccagcctcgggag
tgccacaccttctccgaccccacctgccccggagcccctgcggtgctgcactttcctctg
gtcagcgactccttccgggagtactcggcccctggggtccggcggacacccgaggaggcg
gcagctggggaggtgaacctgtcttcatcggactctccctaccactacacgaaggtgacc
tacagccaggaggacgtggacaagctgctgcacctgacacattacaatgtctgcaacaac
caggagcagctgctggaggctctgcgccaggcagtgcagcggaggcggcagcgcaggccc
cactga

KEGG   Homo sapiens (human): 123745
Entry
123745            CDS       T01001                                 

Gene name
PLA2G4E
Definition
(RefSeq) phospholipase A2 group IVE
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    123745 (PLA2G4E)
   00565 Ether lipid metabolism
    123745 (PLA2G4E)
   00590 Arachidonic acid metabolism
    123745 (PLA2G4E)
   00591 Linoleic acid metabolism
    123745 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    123745 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    123745 (PLA2G4E)
   04010 MAPK signaling pathway
    123745 (PLA2G4E)
   04370 VEGF signaling pathway
    123745 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    123745 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    123745 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    123745 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    123745 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    123745 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    123745 (PLA2G4E)
   04913 Ovarian steroidogenesis
    123745 (PLA2G4E)
   04921 Oxytocin signaling pathway
    123745 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    123745 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    123745 (PLA2G4E)
   04726 Serotonergic synapse
    123745 (PLA2G4E)
   04730 Long-term depression
    123745 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    123745 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    123745 (PLA2G4E)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     123745 (PLA2G4E)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 123745
NCBI-ProteinID: NP_001193599
HGNC: 24791
Ensembl: ENSG00000188089
Vega: OTTHUMG00000130371
Pharos: Q3MJ16(Tdark)
UniProt: Q3MJ16
LinkDB
Position
15q15.1
AA seq 868 aa
MSLQASEGCPGLGTNVFVPQSPQTDEEGSRSGRSFSEFEDTQDLDTPGLPPFCPMAPWGS
EEGLSPCHLLTVRVIRMKNVRQADMLSQTDCFVSLWLPTASQKKLRTRTISNCPNPEWNE
SFNFQIQSRVKNVLELSVCDEDTVTPDDHLLTVLYDLTKLCFRKKTHVKFPLNPQGMEEL
EVEFLLEESPSPPETLVTNGVLVSRQVSCLEVHAQSRRRRKREKMKDLLVMVNESFENTQ
RVRPCLEPCCPTSACFQTAACFHYPKYFQSQVHVEVPKSHWSCGLCCRSRKKGPISQPLD
CLSDGQVMTLPVGESYELHMKSTPCPETLDVRLGFSLCPAELEFLQKRKVVVAKALKQVL
QLEEDLQEDEVPLIAIMATGGGTRSMTSMYGHLLGLQKLNLLDCASYITGLSGATWTMAT
LYRDPDWSSKNLEPAIFEARRHVVKDKLPSLFPDQLRKFQEELRQRSQEGYRVTFTDFWG
LLIETCLGDERNECKLSDQRAALSCGQNPLPIYLTINVKDDVSNQDFREWFEFSPYEVGL
QKYGAFIPSELFGSEFFMGRLVKRIPESRICYMLGLWSSIFSLNLLDAWNLSHTSEEFFH
RWTREKVQDIEDEPILPEIPKCDANILETTVVIPGSWLSNSFREILTHRSFVSEFHNFLS
GLQLHTNYLQNGQFSRWKDTVLDGFPNQLTESANHLCLLDTAFFVNSSYPPLLRPERKAD
LIIHLNYCAGSQTKPLKQTCEYCTVQNIPFPKYELPDENENLKECYLMENPQEPDAPIVT
FFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEATFDKLVKLSEYN
ILNNKDTLLQALRLAVEKKKRLKGQCPS
NT seq 2607 nt   +upstreamnt  +downstreamnt
atgagtctccaggcctcggaaggctgtcctggcctgggaactaatgtgtttgtcccacag
agcccacaaacggatgaagaaggcagcaggtcaggaagaagtttcagtgagttcgaggat
acacaggacctggacactcctggtctcccacctttctgtcctatggctccttggggctct
gaggaggggctgtctccatgccacctgttgacagtgagggtcatccggatgaaaaatgtc
cggcaggctgatatgctgagccagacagactgttttgtgagcctctggctgcccaccgcc
tctcagaagaagctgaggacaaggaccatctccaactgcccaaatccagagtggaatgaa
agcttcaacttccagatccagagccgagtgaagaacgtgctagagttgagtgtctgtgat
gaagacacagtgacaccagatgaccatctcctgacagttctctatgacctcaccaagctc
tgtttccgaaagaaaacccacgtgaagtttccactcaacccgcagggcatggaagagctg
gaggtggagttcctgctggaggagagtccctctccacctgagaccctcgtcaccaatggc
gtgctggtgtctcgacaagtctcctgcctggaggttcatgcacaatccaggaggcggagg
aagagggagaaaatgaaggacctcctggtgatggtgaacgaatcctttgagaacacccag
cgtgtccggccctgcttggaaccctgctgcccaacctctgcctgcttccaaaccgctgcc
tgcttccactaccccaagtacttccagtcccaggtgcacgtggaagtgcccaagagtcac
tggagctgtgggctttgctgccgctctcgcaagaagggccccatcagccagcccctcgac
tgcctttccgatggtcaggtgatgaccctgcctgtgggtgagagttatgaattacacatg
aagtctacaccctgccctgagacactggacgtgcggctgggcttcagcctgtgcccagca
gagctggagtttctgcagaagcggaaggtcgtggtggccaaggccctgaagcaggtgctg
cagctggaggaagacctgcaggaggacgaggtgccgctgatagccatcatggccactggg
ggtggaacaagatccatgacctccatgtatggccacctgctggggctgcagaagctgaac
ctcctggactgtgccagctacatcaccggtctatcaggggccacctggaccatggctacc
ttgtaccgtgaccctgactggtcctccaaaaacttggagcctgctatctttgaggctcgg
agacatgtggtaaaggacaagctaccctccctgttcccagaccagctccgcaaattccag
gaggagctccggcagcgcagccaggaaggctacagggtcacctttacagacttctggggc
ctgctgatagagacctgcctgggggacgagagaaatgaatgcaaactgtcagatcagcgt
gctgctttgagctgcggccagaaccccctgcccatctacctcaccatcaatgtcaaggat
gatgtaagcaaccaggacttcagagagtggttcgagttctccccctacgaggtgggcctg
cagaagtatggggccttcatcccctccgagctcttcggctccgagttcttcatggggcgg
ctggtgaagaggatcccggagtctcgaatctgctacatgctaggcctgtggagcagcatc
ttctccctgaacctgctggatgcctggaacctgtcacacacctcggaggagtttttccac
aggtggacaagggagaaagtgcaggacatcgaagacgagccgatcctgcctgaaatcccc
aaatgtgatgctaacatcctggagaccacggtagtgatcccagggtcatggctgtccaat
tctttccgagaaatccttacccatcggtccttcgtgtctgagtttcacaacttcctgtct
gggctgcagctgcacaccaactacctccagaatggccagttctctaggtggaaagacaca
gtgctagatggtttcccaaaccagctgaccgagtccgcgaaccacctgtgcctgctggac
actgcgttctttgtcaactccagctacccgcccctcctcaggccagagcgaaaagccgac
ctcatcatccacctcaactactgtgctgggtcccagacaaagcccctgaaacaaacctgt
gagtactgcactgtgcagaacatccccttccccaaatacgagctgccagatgagaatgaa
aatctcaaggaatgctacctgatggagaacccccaggaacccgatgcccccatcgtgact
ttcttcccactcatcaatgacactttccgaaaatacaaggcaccaggtgtagagcgaagc
cctgaggagctggagcagggccaggtggacatttatggtcccaaaactccctatgccacc
aaggagctgacatacacagaggccacctttgacaagctggtgaaactctcagagtataac
atcctgaataataaggacactctcctccaggctctgcggctcgcagtggagaagaagaag
cgcctgaagggccagtgtccctcctag

KEGG   Homo sapiens (human): 255189
Entry
255189            CDS       T01001                                 

Gene name
PLA2G4F, PLA2G4FZ
Definition
(RefSeq) phospholipase A2 group IVF
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    255189 (PLA2G4F)
   00565 Ether lipid metabolism
    255189 (PLA2G4F)
   00590 Arachidonic acid metabolism
    255189 (PLA2G4F)
   00591 Linoleic acid metabolism
    255189 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    255189 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    255189 (PLA2G4F)
   04010 MAPK signaling pathway
    255189 (PLA2G4F)
   04370 VEGF signaling pathway
    255189 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    255189 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    255189 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    255189 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    255189 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    255189 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    255189 (PLA2G4F)
   04913 Ovarian steroidogenesis
    255189 (PLA2G4F)
   04921 Oxytocin signaling pathway
    255189 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    255189 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    255189 (PLA2G4F)
   04726 Serotonergic synapse
    255189 (PLA2G4F)
   04730 Long-term depression
    255189 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    255189 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    255189 (PLA2G4F)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     255189 (PLA2G4F)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 255189
NCBI-ProteinID: NP_998765
HGNC: 27396
Ensembl: ENSG00000168907
Vega: OTTHUMG00000172782
Pharos: Q68DD2(Tdark)
UniProt: Q68DD2 A5PKZ7
LinkDB
Position
15q15.1
AA seq 849 aa
MLWALWPRWLADKMLPLLGAVLLQKREKRGPLWRHWRRETYPYYDLQVKVLRATNIRGTD
LLSKADCYVQLWLPTASPSPAQTRIVANCSDPEWNETFHYQIHGAVKNVLELTLYDKDIL
GSDQLSLLLFDLRSLKCGQPHKHTFPLNHQDSQELQVEFVLEKSQVPASEVITNGVLVAH
PCLRIQGTLRGDGTAPREEYGSRQLQLAVPGAYEKPQLLPLQPPTEPGLPPTFTFHVNPV
LSSRLHVELMELLAAVQSGPSAELEAQTSKLGEGGILLSSLPLGQEEQCSVALGEGQEVA
LSMKVEMSSGDLDLRLGFDLSDGEQEFLDRRKQVVSKALQQVLGLSEALDSGQVPVVAVL
GSGGGTRAMSSLYGSLAGLQELGLLDTVTYLSGVSGSTWCISTLYRDPAWSQVALQGPIE
RAQVHVCSSKMGALSTERLQYYTQELGVRERSGHSVSLIDLWGLLVEYLLYQEENPAKLS
DQQEAVRQGQNPYPIYTSVNVRTNLSGEDFAEWCEFTPYEVGFPKYGAYVPTELFGSELF
MGRLLQLQPEPRICYLQGMWGSAFATSLDEIFLKTAGSGLSFLEWYRGSVNITDDCQKPQ
LHNPSRLRTRLLTPQGPFSQAVLDIFTSRFTSAQSFNFTRGLCLHKDYVAGREFVAWKDT
HPDAFPNQLTPMRDCLYLVDGGFAINSPFPLALLPQRAVDLILSFDYSLEAPFEVLKMTE
KYCLDRGIPFPSIEVGPEDMEEARECYLFAKAEDPRSPIVLHFPLVNRTFRTHLAPGVER
QTAEEKAFGDFVINRPDTPYGMMNFTYEPQDFYRLVALSRYNVLNNVETLKCALQLALDR
HQARERAGA
NT seq 2550 nt   +upstreamnt  +downstreamnt
atgctttgggcactctggccaaggtggctggcagacaagatgctgcccctcctgggggca
gtgctgcttcagaagagagagaagaggggccctctgtggaggcactggcggcgggaaacc
tacccatactatgacctccaggtgaaggtgctgagggccacaaacatccggggcacagac
ctgctgtccaaagccgactgctatgtgcaactgtggctgcccacggcgtccccaagccct
gcccagactaggatagtggccaactgcagtgaccccgagtggaatgagaccttccactac
cagatccatggtgctgtgaagaacgtcctggagctcaccctctatgacaaggacatcctg
ggcagcgaccagctctctctgctcctgtttgacctgagaagcctcaagtgtggccaacct
cacaaacacaccttcccactcaaccaccaggattcacaagagctgcaggtggaatttgtt
ctggagaagagccaggtgcctgcatctgaagtcatcaccaacggggttctggtggctcac
ccctgtctgagaatccagggcacgctccggggagatgggacagccccacgggaagagtac
ggctctaggcagctccagctggcagtgcctggagcctacgagaagccacagctcttgccc
ctgcagcctcccacagagccaggcctcccacccacctttaccttccacgtgaacccagtg
ctgagctccaggctacacgtggagctgatggagctgctggcagctgtgcagagtggcccc
agcgcagagttggaggctcagaccagcaagctgggcgaggggggcatcctgctctcctct
ctgcccctaggccaggaggaacagtgttctgtggccctgggggagggccaggaggtggct
ctgagcatgaaggtggaaatgagctccggggacctagacctacgccttggctttgacctc
tctgacggggagcaggagtttctggacaggaggaagcaggtcgtgtccaaggccctgcag
caagtgctgggattgagtgaggctctggacagtggccaggtgcctgtagtggctgtgttg
ggttccgggggtggaacccgagccatgtcttctctgtacggcagcctggcagggttgcag
gagctcggccttctagacactgtgacctacctgagtggggtctctgggtctacctggtgc
atctccacactctacagggacccagcctggtcccaggtggccttgcagggccccattgag
cgtgcccaggttcacgtctgcagcagtaagatgggagctttgtccacggagcggctacag
tactacactcaggaactgggggtccgggagcgcagtggccacagcgtgtccctcatcgac
ctctggggcctccttgttgagtatctcctgtaccaggaggagaaccctgccaagctgtct
gaccaacaggaggcggtccgccagggtcagaacccttaccccatttacaccagtgtcaac
gtccgcaccaacttgagtggggaagattttgcagagtggtgcgagttcacgccctatgag
gttggcttccccaagtacggggcttatgttcccaccgagctcttcggctcagaactcttc
atgggacgattgctgcagctccagcctgaaccccggatctgttacctgcaaggtatgtgg
ggcagcgcctttgccaccagcctggatgagatcttcctaaagaccgccggctcgggcctc
agcttcctggagtggtacagaggcagtgtgaatatcacagacgactgccagaagcctcag
ctgcacaacccctcgaggctgcgaacgaggctcctcaccccacaggggcccttctcccag
gctgtgctggacatattcacctcccgcttcacttccgcccagagctttaacttcacccgg
ggtctctgcttgcacaaggactatgtggctggcagggagttcgtggcctggaaagacaca
cacccggacgccttccccaaccagctcacccccatgcgggactgcctgtacctggtggac
ggaggctttgccatcaactctccgttcccactggctctgctgcctcagagagcagtggac
ctcattctgtcctttgactattccttggaagccccttttgaggtcttgaagatgacagag
aagtactgcctggaccgaggaatccccttccctagcatcgaggtgggccctgaggacatg
gaggaggcccgtgagtgctatctgtttgccaaggctgaggacccccgctcccccattgtg
ctgcacttccccctggttaaccgtaccttccgcacacacctggccccaggtgtggagcga
caaacagctgaggagaaggcctttggggactttgtcatcaacaggccagacaccccctat
ggcatgatgaacttcacctatgagccccaggacttttatcggctggtggccctcagtcga
tacaacgtcctgaacaacgtggagaccttgaagtgcgccctccagctggctctggaccgg
caccaggctcgggagagggcaggggcctga

KEGG   Homo sapiens (human): 26279
Entry
26279             CDS       T01001                                 

Gene name
PLA2G2D, PLA2IID, SPLASH, sPLA2-IID, sPLA2S
Definition
(RefSeq) phospholipase A2 group IID
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    26279 (PLA2G2D)
   00565 Ether lipid metabolism
    26279 (PLA2G2D)
   00590 Arachidonic acid metabolism
    26279 (PLA2G2D)
   00591 Linoleic acid metabolism
    26279 (PLA2G2D)
   00592 alpha-Linolenic acid metabolism
    26279 (PLA2G2D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    26279 (PLA2G2D)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    26279 (PLA2G2D)
  09154 Digestive system
   04972 Pancreatic secretion
    26279 (PLA2G2D)
   04975 Fat digestion and absorption
    26279 (PLA2G2D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    26279 (PLA2G2D)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     26279 (PLA2G2D)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    26279 (PLA2G2D)
SSDB
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N DUF5460
Other DBs
NCBI-GeneID: 26279
NCBI-ProteinID: NP_036532
OMIM: 605630
HGNC: 9033
Ensembl: ENSG00000117215
Vega: OTTHUMG00000002701
Pharos: Q9UNK4(Tchem)
UniProt: Q9UNK4
LinkDB
Position
1p36.12
AA seq 145 aa
MELALLCGLVVMAGVIPIQGGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDAT
DWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLK
RNLDTYQKRLRFYWRPHCRGQTPGC
NT seq 438 nt   +upstreamnt  +downstreamnt
atggaacttgcactgctgtgtgggctggtggtgatggctggtgtgattccaatccagggc
gggatcctgaacctgaacaagatggtcaagcaagtgactgggaaaatgcccatcctctcc
tactggccctacggctgtcactgcggactaggtggcagaggccaacccaaagatgccacg
gactggtgctgccagacccatgactgctgctatgaccacctgaagacccaggggtgcagc
atctacaaggactattacagatacaacttttcccaggggaacatccactgctctgacaag
ggaagctggtgtgagcagcagctgtgtgcctgtgacaaggaggtggccttctgcctgaag
cgcaacctggacacctaccagaagcgactgcgtttctactggcggccccactgccggggg
cagacccctgggtgctag

KEGG   Homo sapiens (human): 283748
Entry
283748            CDS       T01001                                 

Gene name
PLA2G4D, cPLA2delta
Definition
(RefSeq) phospholipase A2 group IVD
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    283748 (PLA2G4D)
   00565 Ether lipid metabolism
    283748 (PLA2G4D)
   00590 Arachidonic acid metabolism
    283748 (PLA2G4D)
   00591 Linoleic acid metabolism
    283748 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    283748 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    283748 (PLA2G4D)
   04010 MAPK signaling pathway
    283748 (PLA2G4D)
   04370 VEGF signaling pathway
    283748 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    283748 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    283748 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    283748 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    283748 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    283748 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    283748 (PLA2G4D)
   04913 Ovarian steroidogenesis
    283748 (PLA2G4D)
   04921 Oxytocin signaling pathway
    283748 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    283748 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    283748 (PLA2G4D)
   04726 Serotonergic synapse
    283748 (PLA2G4D)
   04730 Long-term depression
    283748 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    283748 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    283748 (PLA2G4D)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     283748 (PLA2G4D)
SSDB
Motif
Pfam: cPLA2_C2 PLA2_B C2
Other DBs
NCBI-GeneID: 283748
NCBI-ProteinID: NP_828848
OMIM: 612864
HGNC: 30038
Ensembl: ENSG00000159337
Vega: OTTHUMG00000172587
Pharos: Q86XP0(Tdark)
UniProt: Q86XP0
LinkDB
Structure
PDB: 
5IZ5 5IXC 5IZR

Position
15q15.1
AA seq 818 aa
MESLSPGGPPGHPYQGEASTCWQLTVRVLEARNLRWADLLSEADPYVILQLSTAPGMKFK
TKTLTDTSHPVWNEAFRFLIQSQVKNVLELSIYDEDSVTEDDICFKVLYDISEVLPGKLL
RKTFSQSPQGEEELDVEFLMEETSDRPENLITNKVIVARELSCLDVHLDSTGSTAVVADQ
DKLELELVLKGSYEDTQTSFLGTASAFRFHYMAALETELSGRLRSSRSNGWNGDNSAGYL
TVPLRPLTIGKEVTMDVPAPNAPGVRLQLKAEGCPEELAVHLGFNLCAEEQAFLSRRKQV
VAKALKQALQLDRDLQEDEVPVVGIMATGGGARAMTSLYGHLLALQKLGLLDCVTYFSGI
SGSTWTMAHLYGDPEWSQRDLEGPIRYAREHLAKSKLEVFSPERLASYRRELELRAEQGH
PTTFVDLWALVLESMLHGQVMDQKLSGQRAALERGQNPLPLYLSLNVKENNLETLDFKEW
VEFSPYEVGFLKYGAFVPPELFGSEFFMGRLMRRIPEPRICFLEAIWSNIFSLNLLDAWY
DLTSSGESWKQHIKDKTRSLEKEPLTTSGTSSRLEASWLQPGTALAQAFKGFLTGRPLHQ
RSPNFLQGLQLHQDYCSHKDFSTWADYQLDSMPSQLTPKEPRLCLVDAAYFINTSSPSMF
RPGRRLDLILSFDYSLSAPFEALQQTELYCRARGLPFPRVEPSPQDQHQPRECHLFSDPA
CPEAPILLHFPLVNASFKDHSAPGVQRSPAELQGGQVDLTGATCPYTLSNMTYKEEDFER
LLRLSDYNVQTSQGAILQALRTALKHRTLEARPPRAQT
NT seq 2457 nt   +upstreamnt  +downstreamnt
atggagagcctgtcacctgggggaccacctggccacccttaccagggggaggcctctacc
tgctggcagctcacagtgagggtcctggaggcgcggaacctgcgctgggctgacctgttg
agtgaggccgacccttacgtgatcctacagctgtcgaccgcacctggaatgaagtttaag
accaagacgctcaccgacaccagtcatcctgtgtggaatgaggccttccgtttccttatc
caaagtcaggtcaagaatgttctggagcttagcatctatgatgaggactcagtcacggag
gatgacatctgcttcaaggttctctatgacatctcagaagtcctccctggcaagctgctc
cggaaaaccttctcccagagtccccagggagaggaggagctggatgtggagttcctgatg
gaagaaacgtcagatcgcccagaaaacctcatcaccaacaaagtcattgtggcccgagag
ctgtcatgcctggatgtgcatctggacagcacagggagcaccgctgtggttgcagatcag
gacaagctggagctggagctggtgctgaaggggtcctatgaggacacacagacatccttc
ctgggcacagcctctgccttccgcttccactacatggcagccctagagacagagctgagc
gggcgcctgaggagctccagaagcaatggctggaatggggacaactcagctgggtacctc
actgtgcccctgaggcccttgaccattgggaaggaggtgactatggatgttcctgctcca
aatgccccaggagtgaggctgcagctcaaggcagagggctgccctgaggagctggccgtg
cacctgggcttcaatctctgtgcagaggagcaggccttcctgagcaggaggaagcaggtg
gtggccaaggccctgaagcaggccctgcagctggacagagacctgcaggaggatgaggta
cccgttgtgggcatcatggccacaggaggaggtgcccgggccatgacctcactctacggc
cacctattggccttgcagaagctgggcctcctagactgtgtgacctacttcagtggcatc
tctggctctacgtggacaatggcccacctgtacggggaccctgagtggtcgcagagggac
ctggagggacctatcagatacgcccgggagcacctggccaagagcaagctggaggtcttt
tccccagagcgcctggcgagctaccgccgggagctggagctgcgggctgagcagggccac
cccacgacctttgtggacctgtgggcgctagtgctggagtccatgctgcacggccaggtg
atggatcagaagctgtcaggacagagagccgccctggaacggggtcagaaccctctgccc
ctctacttgagcctcaatgtcaaagagaacaatctggagacactggacttcaaggagtgg
gttgagttctccccctatgaggtcggtttcctgaagtacggggccttcgtccctcctgag
ctcttcggctccgagttcttcatgggacggctgatgaggaggatcccggagccccggatc
tgctttctggaagccatctggagcaacattttctccctgaacctgctggatgcctggtat
gacctcaccagttctggggagtcctggaaacagcacatcaaggacaagaccaggagctta
gagaaggagcccctgaccacctcggggacctcctcgcggctggaggcctcgtggctgcag
ccaggcacggcgctggcccaggcatttaaaggcttcctgacaggcaggcccctccaccag
cgcagccccaacttcctccagggcctccagctgcaccaggactactgtagccacaaagac
ttctccacctgggcagactaccagcttgactccatgcccagccagctgacccccaaggag
ccccggctctgcctggtggacgccgcctacttcatcaacaccagctctccctccatgttc
cggccaggccgcaggctggacctcatcctctccttcgactactccctatctgcgcccttc
gaggcactgcagcagacggagctgtactgccgggcccgggggctgcccttcccccgggtg
gaacccagccctcaggaccagcaccagccaagggaatgccacctcttctcagaccccgcc
tgccccgaggccccgatcctgctgcacttcccgctggtcaatgcctccttcaaggaccac
tcagcccccggtgtccagcgcagccccgcagagctccagggtggccaagtggatctcacc
ggggccacctgcccctacaccctgtccaacatgacctacaaggaggaagacttcgagcgc
ctgctgcggctcagtgactacaacgtgcagaccagccagggtgccatcctgcaggccctg
aggaccgcgctgaagcaccggactctagaggcgaggcctccaagggcacagacctga

KEGG   Homo sapiens (human): 30814
Entry
30814             CDS       T01001                                 

Gene name
PLA2G2E, GIIE_sPLA2, sPLA2-IIE
Definition
(RefSeq) phospholipase A2 group IIE
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    30814 (PLA2G2E)
   00565 Ether lipid metabolism
    30814 (PLA2G2E)
   00590 Arachidonic acid metabolism
    30814 (PLA2G2E)
   00591 Linoleic acid metabolism
    30814 (PLA2G2E)
   00592 alpha-Linolenic acid metabolism
    30814 (PLA2G2E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    30814 (PLA2G2E)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    30814 (PLA2G2E)
  09154 Digestive system
   04972 Pancreatic secretion
    30814 (PLA2G2E)
   04975 Fat digestion and absorption
    30814 (PLA2G2E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    30814 (PLA2G2E)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     30814 (PLA2G2E)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    30814 (PLA2G2E)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 30814
NCBI-ProteinID: NP_055404
OMIM: 618320
HGNC: 13414
Ensembl: ENSG00000188784
Vega: OTTHUMG00000002702
Pharos: Q9NZK7(Tchem)
UniProt: Q9NZK7
LinkDB
Structure
PDB: 

Position
1p36.13
AA seq 142 aa
MKSPHVLVFLCLLVALVTGNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDW
CCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNL
GTYNRKYAHYPNKLCTGPTPPC
NT seq 429 nt   +upstreamnt  +downstreamnt
atgaaatctccccacgtgctggtgttcctttgcctcctggtggctctggtcaccgggaac
ctggttcagtttggggtgatgatcgagaagatgacaggcaagtccgccctgcagtacaac
gactatggctgttactgcggcatcggtggctcccactggccggtggaccagactgactgg
tgctgccacgcccacgactgctgctacgggcgtctggagaagctgggctgtgagcccaaa
ctggaaaagtatcttttctctgtcagcgaacgtggcattttctgcgccggcaggaccacc
tgccagcggctgacctgcgagtgtgacaagagggctgccctctgctttcgccgcaacctg
ggcacctacaaccgcaaatatgcccattatcccaacaagctgtgcaccgggcccaccccg
ccctgctga

KEGG   Homo sapiens (human): 391013
Entry
391013            CDS       T01001                                 

Gene name
PLA2G2C, UBXN10-AS1
Definition
(RefSeq) phospholipase A2 group IIC
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    391013 (PLA2G2C)
   00565 Ether lipid metabolism
    391013 (PLA2G2C)
   00590 Arachidonic acid metabolism
    391013 (PLA2G2C)
   00591 Linoleic acid metabolism
    391013 (PLA2G2C)
   00592 alpha-Linolenic acid metabolism
    391013 (PLA2G2C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    391013 (PLA2G2C)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    391013 (PLA2G2C)
  09154 Digestive system
   04972 Pancreatic secretion
    391013 (PLA2G2C)
   04975 Fat digestion and absorption
    391013 (PLA2G2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    391013 (PLA2G2C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     391013 (PLA2G2C)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    391013 (PLA2G2C)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 391013
NCBI-ProteinID: NP_001303651
HGNC: 9032
Ensembl: ENSG00000187980 ENSG00000225986
Vega: OTTHUMG00000002705
LinkDB
Position
1p36.12
AA seq 150 aa
MKVIAILTLLLFCSPTHSSFWQFQRRVKHITGRSAFFSYYGYGCYCGLGDKGIPVDDTDS
PSSPSPYEKLKEFSCQPVLNSYQFHIVNGAVVCGCTLGPGASCHCRLKACECDKQSVHCF
KESLPTYEKNFKQFSSQPRTAAPTLQKSLG
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaaggtcattgccatcctcaccctcctcctcttctgctcccccacccacagcagtttc
tggcagtttcagaggagggtcaaacacatcacggggcgaagtgccttcttctcatattac
ggatatggctgctactgtgggcttggggataaagggatccccgtggatgacactgacagc
ccctcatctccctctccctacgagaagctgaaggagttcagctgccagcctgtgttgaac
agctaccagttccacatcgtcaatggcgcagtggtttgtggatgcacccttggtcctggt
gccagctgccactgcaggctgaaggcctgtgagtgtgacaagcaatccgtgcactgcttc
aaagagagcctgcccacctatgagaaaaacttcaagcagttctccagccagcccaggaca
gctgcccccaccctgcaaaaaagcctgggctag

KEGG   Homo sapiens (human): 50487
Entry
50487             CDS       T01001                                 

Gene name
PLA2G3, GIII-SPLA2, SPLA2III, sPLA2-III
Definition
(RefSeq) phospholipase A2 group III
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    50487 (PLA2G3)
   00565 Ether lipid metabolism
    50487 (PLA2G3)
   00590 Arachidonic acid metabolism
    50487 (PLA2G3)
   00591 Linoleic acid metabolism
    50487 (PLA2G3)
   00592 alpha-Linolenic acid metabolism
    50487 (PLA2G3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    50487 (PLA2G3)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    50487 (PLA2G3)
  09154 Digestive system
   04972 Pancreatic secretion
    50487 (PLA2G3)
   04975 Fat digestion and absorption
    50487 (PLA2G3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    50487 (PLA2G3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     50487 (PLA2G3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    50487 (PLA2G3)
SSDB
Motif
Pfam: Phospholip_A2_2 Chromadorea_ALT
Other DBs
NCBI-GeneID: 50487
NCBI-ProteinID: NP_056530
OMIM: 611651
HGNC: 17934
Ensembl: ENSG00000100078
Vega: OTTHUMG00000151255
Pharos: Q9NZ20(Tbio)
UniProt: Q9NZ20
LinkDB
Position
22q12.2
AA seq 509 aa
MGVQAGLFGMLGFLGVALGGSPALRWYRTSCHLTKAVPGNPLGYLSFLAKDAQGLALIHA
RWDAHRRLQSCSWEDEPELTAAYGALCAHETAWGSFIHTPGPELQRALATLQSQWEACRA
LEESPAGARKKRAAGQSGVPGGGHQREKRGWTMPGTLWCGVGDSAGNSSELGVFQGPDLC
CREHDRCPQNISPLQYNYGIRNYRFHTISHCDCDTRFQQCLQNQHDSISDIVGVAFFNVL
EIPCFVLEEQEACVAWYWWGGCRMYGTVPLARLQPRTFYNASWSSRATSPTPSSRSPAPP
KPRQKQHLRKGPPHQKGSKRPSKANTTALQDPMVSPRLDVAPTGLQGPQGGLKPQGARWV
CRSFRRHLDQCEHQIGPREIEFQLLNSAQEPLFHCNCTRRLARFLRLHSPPEVTNMLWEL
LGTTCFKLAPPLDCVEGKNCSRDPRAIRVSARHLRRLQQRRHQLQDKGTDERQPWPSEPL
RGPMSFYNQCLQLTQAARRPDRQQKSWSQ
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgggggttcaggcagggctgtttgggatgctgggcttcctgggggtggccctggggggc
tcccctgccctccgctggtacaggacctcctgccacttgaccaaggccgtccctggcaac
ccactggggtacctgagcttcctggccaaggatgctcagggactggccctgatccatgcc
cgctgggatgcgcataggaggctgcagtcatgtagctgggaggatgagccggagctcacc
gcagcctacggtgctctctgtgctcatgagactgcctggggctccttcatccacaccccc
ggacccgagctgcagagagcactggccactcttcagagtcagtgggaggcatgccgagcg
cttgaggagagtccagcaggggccaggaagaagcgagcagcagggcagagtggagtccct
ggtggagggcaccagcgagagaagagaggatggaccatgcctggcacactgtggtgtgga
gttggagattctgctgggaactcctcggagctgggggtcttccagggacctgatctctgt
tgccgggaacatgaccgctgcccacagaacatctcacccttgcagtacaactatggcatc
cgaaactaccgattccacaccatctcccactgtgactgtgacaccaggtttcagcaatgc
ctacagaatcagcacgactccatctcggacatcgtgggcgtggccttcttcaacgtgctg
gagatcccctgctttgtgctggaggagcaggaggcgtgtgtggcgtggtactggtggggc
gggtgtaggatgtacggcacagtgcccctcgctcgcctgcagcccaggaccttctacaat
gcctcctggagctcccgggccacctccccaactcccagctcccggagcccagcccctccc
aagcctcgacagaagcagcaccttcggaaggggccaccacatcagaaagggtccaagcgc
cccagcaaagccaacaccacagccctccaggaccctatggtctctcccaggcttgatgtg
gcccccacaggcctccagggcccacagggtggcctaaaacctcagggtgcccgctgggtc
tgccgcagcttccgccgccacctggaccagtgtgagcaccagattgggccccgggaaatc
gagttccagctgctcaacagcgcccaagagcccctcttccactgcaactgcacgcgccgt
ctggcacgcttcctgaggctccacagcccacccgaggttaccaacatgctttgggagctg
ctgggcacaacctgcttcaagctggcccctccactggactgtgtggaaggcaaaaactgt
tccagagaccctagggccatcagggtgtcagcccggcacttgcggaggcttcagcagagg
cgacaccagctccaggataaaggcacagatgagaggcagccatggccttcagagcccctg
agaggccccatgtcattctacaaccagtgcctgcagctaacccaggcagccaggagaccc
gacaggcagcagaagtcctggagccagtga

KEGG   Homo sapiens (human): 5319
Entry
5319              CDS       T01001                                 

Gene name
PLA2G1B, PLA2, PLA2A, PPLA2
Definition
(RefSeq) phospholipase A2 group IB
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    5319 (PLA2G1B)
   00565 Ether lipid metabolism
    5319 (PLA2G1B)
   00590 Arachidonic acid metabolism
    5319 (PLA2G1B)
   00591 Linoleic acid metabolism
    5319 (PLA2G1B)
   00592 alpha-Linolenic acid metabolism
    5319 (PLA2G1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5319 (PLA2G1B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    5319 (PLA2G1B)
  09154 Digestive system
   04972 Pancreatic secretion
    5319 (PLA2G1B)
   04975 Fat digestion and absorption
    5319 (PLA2G1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5319 (PLA2G1B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     5319 (PLA2G1B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    5319 (PLA2G1B)
SSDB
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N Phospholip_A2_2 DUF1644
Other DBs
NCBI-GeneID: 5319
NCBI-ProteinID: NP_000919
OMIM: 172410
HGNC: 9030
Ensembl: ENSG00000170890
Vega: OTTHUMG00000169343
Pharos: P04054(Tchem)
UniProt: P04054
LinkDB
Structure
PDB: 
3ELO

Position
12q24.31
AA seq 148 aa
MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPV
DELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNC
DRNAAICFSKAPYNKAHKNLDTKKYCQS
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaaactccttgtgctagctgtgctgctcacagtggccgccgccgacagcggcatcagc
cctcgggccgtgtggcagttccgcaaaatgatcaagtgcgtgatcccggggagtgacccc
ttcttggaatacaacaactacggctgctactgtggcttggggggctcaggcacccccgtg
gatgaactggacaagtgctgccagacacatgacaactgctatgaccaggccaagaagctg
gacagctgtaaatttctgctggacaacccgtacacccacacctattcatactcgtgctct
ggctcggcaatcacctgtagcagcaaaaacaaagagtgtgaggccttcatttgcaactgc
gaccgcaacgctgccatctgcttttcaaaagctccatataacaaggcacacaagaacctg
gacaccaagaagtattgtcagagttga

KEGG   Homo sapiens (human): 5320
Entry
5320              CDS       T01001                                 

Gene name
PLA2G2A, MOM1, PLA2, PLA2B, PLA2L, PLA2S, PLAS1, sPLA2
Definition
(RefSeq) phospholipase A2 group IIA
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    5320 (PLA2G2A)
   00565 Ether lipid metabolism
    5320 (PLA2G2A)
   00590 Arachidonic acid metabolism
    5320 (PLA2G2A)
   00591 Linoleic acid metabolism
    5320 (PLA2G2A)
   00592 alpha-Linolenic acid metabolism
    5320 (PLA2G2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5320 (PLA2G2A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    5320 (PLA2G2A)
  09154 Digestive system
   04972 Pancreatic secretion
    5320 (PLA2G2A)
   04975 Fat digestion and absorption
    5320 (PLA2G2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5320 (PLA2G2A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     5320 (PLA2G2A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    5320 (PLA2G2A)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 5320
NCBI-ProteinID: NP_000291
OMIM: 172411
HGNC: 9031
Ensembl: ENSG00000188257
Vega: OTTHUMG00000002699
Pharos: P14555(Tchem)
UniProt: P14555 A0A024RA96
LinkDB
Structure
PDB: 

Position
1p36.13
AA seq 144 aa
MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDAT
DRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFAR
NKTTYNKKYQYYSNKHCRGSTPRC
NT seq 435 nt   +upstreamnt  +downstreamnt
atgaagaccctcctactgttggcagtgatcatgatctttggcctactgcaggcccatggg
aatttggtgaatttccacagaatgatcaagttgacgacaggaaaggaagccgcactcagt
tatggcttctacggctgccactgtggcgtgggtggcagaggatcccccaaggatgcaacg
gatcgctgctgtgtcactcatgactgttgctacaaacgtctggagaaacgtggatgtggc
accaaatttctgagctacaagtttagcaactcggggagcagaatcacctgtgcaaaacag
gactcctgcagaagtcaactgtgtgagtgtgataaggctgctgccacctgttttgctaga
aacaagacgacctacaataaaaagtaccagtactattccaataaacactgcagagggagc
acccctcgttgctga

KEGG   Homo sapiens (human): 5321
Entry
5321              CDS       T01001                                 

Gene name
PLA2G4A, GURDP, PLA2G4, cPLA2, cPLA2-alpha
Definition
(RefSeq) phospholipase A2 group IVA
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Drug target
Ecopladib: D03938
Efipladib: D06674
Giripladib: D06600
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    5321 (PLA2G4A)
   00565 Ether lipid metabolism
    5321 (PLA2G4A)
   00590 Arachidonic acid metabolism
    5321 (PLA2G4A)
   00591 Linoleic acid metabolism
    5321 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    5321 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5321 (PLA2G4A)
   04010 MAPK signaling pathway
    5321 (PLA2G4A)
   04370 VEGF signaling pathway
    5321 (PLA2G4A)
   04072 Phospholipase D signaling pathway
    5321 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    5321 (PLA2G4A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5321 (PLA2G4A)
   04664 Fc epsilon RI signaling pathway
    5321 (PLA2G4A)
   04666 Fc gamma R-mediated phagocytosis
    5321 (PLA2G4A)
  09152 Endocrine system
   04912 GnRH signaling pathway
    5321 (PLA2G4A)
   04913 Ovarian steroidogenesis
    5321 (PLA2G4A)
   04921 Oxytocin signaling pathway
    5321 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    5321 (PLA2G4A)
  09156 Nervous system
   04724 Glutamatergic synapse
    5321 (PLA2G4A)
   04726 Serotonergic synapse
    5321 (PLA2G4A)
   04730 Long-term depression
    5321 (PLA2G4A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5321 (PLA2G4A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    5321 (PLA2G4A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     5321 (PLA2G4A)
SSDB
Motif
Pfam: PLA2_B C2
Other DBs
NCBI-GeneID: 5321
NCBI-ProteinID: NP_077734
OMIM: 600522
HGNC: 9035
Ensembl: ENSG00000116711
Vega: OTTHUMG00000035512
Pharos: P47712(Tchem)
UniProt: P47712
LinkDB
Structure
PDB: 
1RLW 1CJY 1BCI

Position
1q31.1
AA seq 749 aa
MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRT
RHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFTVSSMKVGEKKEV
PFIFNQVTEMVLEMSLEVCSCPDLRFSMALCDQEKTFRQQRKEHIRESMKKLLGPKNSEG
LHSARDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYVAGLSGSTWYMSTLYSH
PDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKSSGQPVTFTDIFGMLIG
ETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEE
LENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQSDNQASWIHRMIMALVSDSALFN
TREGRAGKVHNFMLGLNLNTSYPLSPLSDFATQDSFDDDELDAAVADPDEFERIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMN
KLPFPKIDPYVFDREGLKECYVFKPKNPDMEKDCPTIIHFVLANINFRKYRAPGVPRETE
EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRR
QNPSRCSVSLSNVEARRFFNKEFLSKPKA
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgtcatttatagatccttaccagcacattatagtggagcaccagtattcccacaagttt
acggtagtggtgttacgtgccaccaaagtgacaaagggggcctttggtgacatgcttgat
actccagatccctatgtggaactttttatctctacaacccctgacagcaggaagagaaca
agacatttcaataatgacataaaccctgtgtggaatgagacctttgaatttattttggat
cctaatcaggaaaatgttttggagattacgttaatggatgccaattatgtcatggatgaa
actctagggacagcaacatttactgtatcttctatgaaggtgggagaaaagaaagaagtt
ccttttattttcaaccaagtcactgaaatggttctagaaatgtctcttgaagtttgctca
tgcccagacctacgatttagtatggctctgtgtgatcaggagaagactttcagacaacag
agaaaagaacacataagggagagcatgaagaaactcttgggtccaaagaatagtgaagga
ttgcattctgcacgtgatgtgcctgtggtagccatattgggttcaggtgggggtttccga
gccatggtgggattctctggtgtgatgaaggcattatacgaatcaggaattctggattgt
gctacctacgttgctggtctttctggctccacctggtatatgtcaaccttgtattctcac
cctgattttccagagaaagggccagaggagattaatgaagaactaatgaaaaatgttagc
cacaatccccttttacttctcacaccacagaaagttaaaagatatgttgagtctttatgg
aagaagaaaagctctggacaacctgtcacctttactgatatctttgggatgttaatagga
gaaacactaattcataatagaatgaatactactctgagcagtttgaaggaaaaagttaat
actgcacaatgccctttacctcttttcacctgtcttcatgtcaaacctgacgtttcagag
ctgatgtttgcagattgggttgaatttagtccatacgaaattggcatggctaaatatggt
acttttatggctcccgacttatttggaagcaaattttttatgggaacagtcgttaagaag
tatgaagaaaaccccttgcatttcttaatgggtgtctggggcagtgccttttccatattg
ttcaacagagttttgggcgtttctggttcacaaagcagaggctccacaatggaggaagaa
ttagaaaatattaccacaaagcatattgtgagtaatgatagctcggacagtgatgatgaa
tcacacgaacccaaaggcactgaaaatgaagatgctggaagtgactatcaaagtgataat
caagcaagttggattcatcgtatgataatggccttggtgagtgattcagctttattcaat
accagagaaggacgtgctgggaaggtacacaacttcatgctgggcttgaatctcaataca
tcttatccactgtctcctttgagtgactttgccacacaggactcctttgatgatgatgaa
ctggatgcagctgtagcagatcctgatgaatttgagcgaatatatgagcctctggatgtc
aaaagtaaaaagattcatgtagtggacagtgggctcacatttaacctgccgtatcccttg
atactgagacctcagagaggggttgatctcataatctcctttgacttttctgcaaggcca
agtgactctagtcctccgttcaaggaacttctacttgcagaaaagtgggctaaaatgaac
aagctcccctttccaaagattgatccttatgtgtttgatcgggaagggctgaaggagtgc
tatgtctttaaacccaagaatcctgatatggagaaagattgcccaaccatcatccacttt
gttctggccaacatcaacttcagaaagtacagggctccaggtgttccaagggaaactgag
gaagagaaagaaatcgctgactttgatatttttgatgacccagaatcaccattttcaacc
ttcaattttcaatatccaaatcaagcattcaaaagactacatgatcttatgcacttcaat
actctgaacaacattgatgtgataaaagaagccatggttgaaagcattgaatatagaaga
cagaatccatctcgttgctctgtttcccttagtaatgttgaggcaagaagatttttcaac
aaggagtttctaagtaaacccaaagcatag

KEGG   Homo sapiens (human): 5322
Entry
5322              CDS       T01001                                 

Gene name
PLA2G5, FRFB, GV-PLA2, PLA2-10, hVPLA(2)
Definition
(RefSeq) phospholipase A2 group V
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    5322 (PLA2G5)
   00565 Ether lipid metabolism
    5322 (PLA2G5)
   00590 Arachidonic acid metabolism
    5322 (PLA2G5)
   00591 Linoleic acid metabolism
    5322 (PLA2G5)
   00592 alpha-Linolenic acid metabolism
    5322 (PLA2G5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5322 (PLA2G5)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    5322 (PLA2G5)
  09154 Digestive system
   04972 Pancreatic secretion
    5322 (PLA2G5)
   04975 Fat digestion and absorption
    5322 (PLA2G5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5322 (PLA2G5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     5322 (PLA2G5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    5322 (PLA2G5)
SSDB
Motif
Pfam: Phospholip_A2_1 Phospholip_A2_2
Other DBs
NCBI-GeneID: 5322
NCBI-ProteinID: NP_000920
OMIM: 601192
HGNC: 9038
Ensembl: ENSG00000127472
Vega: OTTHUMG00000002698
Pharos: P39877(Tchem)
UniProt: P39877
LinkDB
Position
1p36.13
AA seq 138 aa
MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGT
DWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKR
NLRSYNPQYQYFPNILCS
NT seq 417 nt   +upstreamnt  +downstreamnt
atgaaaggcctcctcccactggcttggttcctggcttgtagtgtgcctgctgtgcaagga
ggcttgctggacctaaaatcaatgatcgagaaggtgacagggaagaacgccctgacaaac
tacggcttctacggctgttactgcggctggggcggccgaggaacccccaaggatggcacc
gattggtgctgttgggcgcatgaccactgctatgggcggctggaggagaagggctgcaac
attcgcacacagtcctacaaatacagattcgcgtggggcgtggtcacctgcgagcccggg
cccttctgccatgtgaacctctgtgcctgtgaccggaagctcgtctactgcctcaagaga
aacctacggagctacaacccacagtaccaatactttcccaacatcctctgctcctag

KEGG   Homo sapiens (human): 64600
Entry
64600             CDS       T01001                                 

Gene name
PLA2G2F, GIIFsPLA2, sPLA2-IIF
Definition
(RefSeq) phospholipase A2 group IIF
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    64600 (PLA2G2F)
   00565 Ether lipid metabolism
    64600 (PLA2G2F)
   00590 Arachidonic acid metabolism
    64600 (PLA2G2F)
   00591 Linoleic acid metabolism
    64600 (PLA2G2F)
   00592 alpha-Linolenic acid metabolism
    64600 (PLA2G2F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    64600 (PLA2G2F)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    64600 (PLA2G2F)
  09154 Digestive system
   04972 Pancreatic secretion
    64600 (PLA2G2F)
   04975 Fat digestion and absorption
    64600 (PLA2G2F)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    64600 (PLA2G2F)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     64600 (PLA2G2F)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    64600 (PLA2G2F)
SSDB
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N
Other DBs
NCBI-GeneID: 64600
NCBI-ProteinID: NP_073730
OMIM: 616793
HGNC: 30040
Ensembl: ENSG00000158786
Vega: OTTHUMG00000002704
Pharos: Q9BZM2(Tchem)
UniProt: Q9BZM2
LinkDB
Position
1p36.12
AA seq 211 aa
MADGAKANPKGFKKKVLDRCFSGWRGPRFGASCPSRTSRSSLGMKKFFTVAILAGSVLST
AHGSLLNLKAMVEAVTGRSAILSFVGYGCYCGLGGRGQPKDEVDWCCHAHDCCYQELFDQ
GCHPYVDHYDHTIENNTEIVCSDLNKTECDKQTCMCDKNMVLCLMNQTYREEYRGFLNVY
CQGPTPNCSIYEPPPEEVTCSHQSPAPPAPP
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcagatggggcaaaggccaaccccaaagggttcaaaaagaaggtgctggatagatgc
ttctctgggtggaggggcccacgcttcggggcctcctgtccttcaagaacctccaggtct
agcctgggtatgaagaagttcttcaccgtggccatccttgctggcagcgttctgtccaca
gctcacggcagcctgctcaacctgaaggccatggtggaggccgtcacagggaggagcgcc
atcctgtccttcgtgggctacggttgctactgtgggctggggggccgtggccagcccaag
gatgaggtggactggtgctgccacgcccacgactgctgctaccaggaactctttgaccaa
ggctgtcacccctatgtggaccactatgatcacaccatcgagaacaacactgagatagtc
tgcagtgacctcaacaagacagagtgtgacaagcagacatgcatgtgtgacaagaacatg
gttctgtgcctcatgaaccagacgtaccgagaggagtaccgtggcttcctcaatgtctac
tgccagggccccacgcccaactgcagcatctatgaaccgccccctgaggaggtcacctgc
agtcaccaatccccagcgccccccgcccctccctag

KEGG   Homo sapiens (human): 81579
Entry
81579             CDS       T01001                                 

Gene name
PLA2G12A, GXII, PLA2G12, ROSSY
Definition
(RefSeq) phospholipase A2 group XIIA
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    81579 (PLA2G12A)
   00565 Ether lipid metabolism
    81579 (PLA2G12A)
   00590 Arachidonic acid metabolism
    81579 (PLA2G12A)
   00591 Linoleic acid metabolism
    81579 (PLA2G12A)
   00592 alpha-Linolenic acid metabolism
    81579 (PLA2G12A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    81579 (PLA2G12A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    81579 (PLA2G12A)
  09154 Digestive system
   04972 Pancreatic secretion
    81579 (PLA2G12A)
   04975 Fat digestion and absorption
    81579 (PLA2G12A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    81579 (PLA2G12A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     81579 (PLA2G12A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    81579 (PLA2G12A)
SSDB
Motif
Pfam: PLA2G12
Other DBs
NCBI-GeneID: 81579
NCBI-ProteinID: NP_110448
OMIM: 611652
HGNC: 18554
Ensembl: ENSG00000123739
Vega: OTTHUMG00000131915
Pharos: Q9BZM1(Tbio)
UniProt: Q9BZM1 Q542Y6
LinkDB
Position
4q25
AA seq 189 aa
MALLSRPALTLLLLLMAAVVRCQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGED
GLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKS
KNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACR
CHYEEKTDL
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgctctcgcgccccgcgctcaccctcctgctcctcctcatggccgctgttgtc
aggtgccaggagcaggcccagaccaccgactggagagccaccctgaagaccatccggaac
ggcgttcataagatagacacgtacctgaacgccgccttggacctcctgggaggcgaggac
ggtctctgccagtataaatgcagtgacggatctaagcctttcccacgttatggttataaa
ccctccccaccgaatggatgtggctctccactgtttggtgttcatcttaacattggtatc
ccttccctgacaaagtgttgcaaccaacacgacaggtgctatgagacctgtggcaaaagc
aagaatgactgtgatgaagaattccagtattgcctctccaagatctgccgagatgtacag
aaaacactaggactaactcagcatgttcaggcatgtgaaacaacagtggagctcttgttt
gacagtgttatacatttaggttgtaaaccatatctggacagccaacgagccgcatgcagg
tgtcattatgaagaaaaaactgatctttaa

KEGG   Homo sapiens (human): 8398
Entry
8398              CDS       T01001                                 

Gene name
PLA2G6, CaI-PLA2, GVI, INAD1, IPLA2-VIA, NBIA2, NBIA2A, NBIA2B, PARK14, PLA2, PNPLA9, iPLA2, iPLA2beta
Definition
(RefSeq) phospholipase A2 group VI
  KO
K16343  calcium-independent phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04666  Fc gamma R-mediated phagocytosis
hsa04750  Inflammatory mediator regulation of TRP channels
Disease
H00057  Parkinson disease
H00833  Neurodegeneration with brain iron accumulation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    8398 (PLA2G6)
   00565 Ether lipid metabolism
    8398 (PLA2G6)
   00590 Arachidonic acid metabolism
    8398 (PLA2G6)
   00591 Linoleic acid metabolism
    8398 (PLA2G6)
   00592 alpha-Linolenic acid metabolism
    8398 (PLA2G6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    8398 (PLA2G6)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    8398 (PLA2G6)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    8398 (PLA2G6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    8398 (PLA2G6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    8398 (PLA2G6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     8398 (PLA2G6)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    8398 (PLA2G6)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank Ank_3 Patatin
Other DBs
NCBI-GeneID: 8398
NCBI-ProteinID: NP_003551
OMIM: 603604
HGNC: 9039
Ensembl: ENSG00000184381
Vega: OTTHUMG00000151246
Pharos: O60733(Tchem)
UniProt: O60733
LinkDB
Position
22q13.1
AA seq 806 aa
MQFFGRLVNTFSGVTNLFSNPFRVKEVAVADYTSSDRVREEGQLILFQNTPNRTWDCVLV
NPRNSQSGFRLFQLELEADALVNFHQYSSQLLPFYESSPQVLHTEVLQHLTDLIRNHPSW
SVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMD
VTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLL
LCNARCNIMGPNGYPIHSAMKFSQKGCAEMIISMDSSQIHSKDPRYGASPLHWAKNAEMA
RMLLKRGCNVNSTSSAGNTALHVAVMRNRFDCAIVLLTHGANADARGEHGNTPLHLAMSK
DNVEMIKALIVFGAEVDTPNDFGETPTFLASKIGRLVTRKAILTLLRTVGAEYCFPPIHG
VPAEQGSAAPHHPFSLERAQPPPISLNNLELQDLMHISRARKPAFILGSMRDEKRTHDHL
LCLDGGGVKGLIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAILHSKSMAYMRGM
YFRMKDEVFRGSRPYESGPLEEFLKREFGEHTKMTDVRKPKVMLTGTLSDRQPAELHLFR
NYDAPETVREPRFNQNVNLRPPAQPSDQLVWRAARSSGAAPTYFRPNGRFLDGGLLANNP
TLDAMTEIHEYNQDLIRKGQANKVKKLSIVVSLGTGRSPQVPVTCVDVFRPSNPWELAKT
VFGAKELGKMVVDCCTDPDGRAVDRARAWCEMVGIQYFRLNPQLGTDIMLDEVSDTVLVN
ALWETEVYIYEHREEFQKLIQLLLSP
NT seq 2421 nt   +upstreamnt  +downstreamnt
atgcagttctttggccgcctggtcaataccttcagtggcgtcaccaacttgttctctaac
ccattccgggtgaaggaggtggctgtggccgactacacctcgagtgaccgagttcgggag
gaagggcagctgattctgttccagaacactcccaaccgcacctgggactgcgtcctggtc
aaccccaggaactcacagagtggattccgactcttccagctggagttggaggctgacgcc
ctagtgaatttccatcagtattcttcccagctgctacccttctatgagagctcccctcag
gtcctgcacactgaggtcctgcagcacctgaccgacctcatccgtaaccaccccagctgg
tcagtggcccacctggctgtggagctagggatccgcgagtgcttccatcacagccgtatc
atcagctgtgccaattgcgcggagaacgaggagggctgcacacccctgcacctggcctgc
cgcaagggtgatggggagatcctggtggagctggtgcagtactgccacactcagatggat
gtcaccgactacaagggagagaccgtcttccattatgctgtccagggtgacaattctcag
gtgctgcagctccttggaaggaacgcagtggctggcctgaaccaggtgaataaccaaggg
ctgaccccgctgcacctggcctgccagctggggaagcaggagatggtccgcgtgctgctg
ctgtgcaatgctcggtgcaacatcatgggccccaacggctaccccatccactcggccatg
aagttctctcagaaggggtgtgcggagatgatcatcagcatggacagcagccagatccac
agcaaagacccccgttacggagccagccccctccactgggccaagaacgcagagatggcc
cgcatgctgctgaaacggggctgcaacgtgaacagcaccagctccgcggggaacacggcc
ctgcacgtggcggtgatgcgcaaccgcttcgactgtgccatagtgctgctgacccacggg
gccaacgcggatgcccgcggagagcacggcaacaccccgctgcacctggccatgtcgaaa
gacaacgtggagatgatcaaggccctcatcgtgttcggagcagaagtggacaccccgaat
gactttggggagactcctacattcctagcctccaaaatcggcagacttgtcaccaggaag
gcgatcttgactctgctgagaaccgtgggggccgaatactgcttcccacccatccacggg
gtccccgcggagcagggctctgcagcgccacatcatcccttctccctggaaagagctcag
cccccaccgatcagcctaaacaacctagaactacaggatctcatgcacatctcacgggcc
cggaagccagcgttcatcctgggctccatgagggacgagaagcggacccacgaccacctg
ctgtgcctggatggaggaggagtgaaaggcctcatcatcatccagctcctcatcgccatc
gagaaggcctcgggtgtggccaccaaggacctgtttgactgggtggcgggcaccagcact
ggaggcatcctggccctggccattctgcacagtaagtccatggcctacatgcgcggcatg
tactttcgcatgaaggatgaggtgttccggggctccaggccctacgagtcggggcccctg
gaggagttcctgaagcgggagtttggggagcacaccaagatgacggacgtcaggaaaccc
aaggtgatgctgacagggacactgtctgaccggcagccggctgaactccacctcttccgg
aactacgatgctccagaaactgtccgggagcctcgtttcaaccagaacgttaacctcagg
cctccagctcagccctcagaccagctggtgtggcgggcggcccgaagcagcggggcagct
cctacttacttccgacccaatgggcgcttcctggacggtgggctgctggccaacaacccc
acgctggatgccatgaccgagatccatgagtacaatcaggacctgatccgcaagggtcag
gccaacaaggtgaagaaactctccatcgttgtctccctggggacagggaggtccccacaa
gtgcctgtgacctgtgtggatgtcttccgtcccagcaacccctgggagctggccaagact
gtttttggggccaaggaactgggcaagatggtggtggactgttgcacggatccagacggg
cgggctgtggaccgggcacgggcctggtgcgagatggtcggcatccagtacttcagattg
aacccccagctggggacggacatcatgctggatgaggtcagtgacacagtgctggtcaac
gccctctgggagaccgaggtctacatctatgagcaccgcgaggagttccagaagctcatc
cagctgctgctctcaccctga

KEGG   Homo sapiens (human): 8399
Entry
8399              CDS       T01001                                 

Gene name
PLA2G10, GXPLA2, GXSPLA2, SPLA2, sPLA2-X
Definition
(RefSeq) phospholipase A2 group X
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    8399 (PLA2G10)
   00565 Ether lipid metabolism
    8399 (PLA2G10)
   00590 Arachidonic acid metabolism
    8399 (PLA2G10)
   00591 Linoleic acid metabolism
    8399 (PLA2G10)
   00592 alpha-Linolenic acid metabolism
    8399 (PLA2G10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    8399 (PLA2G10)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    8399 (PLA2G10)
  09154 Digestive system
   04972 Pancreatic secretion
    8399 (PLA2G10)
   04975 Fat digestion and absorption
    8399 (PLA2G10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8399 (PLA2G10)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     8399 (PLA2G10)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    8399 (PLA2G10)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 8399
NCBI-ProteinID: NP_003552
OMIM: 603603
HGNC: 9029
Ensembl: ENSG00000069764
Vega: OTTHUMG00000048069
Pharos: O15496(Tchem)
UniProt: O15496
LinkDB
Structure
PDB: 

Position
16p13.12
AA seq 165 aa
MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPI
AYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGP
AENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD
NT seq 498 nt   +upstreamnt  +downstreamnt
atggggccgctacctgtgtgcctgccaatcatgctgctcctgctactgccgtcgctgctg
ctgctgctgcttctacctggccccgggtccggcgaggcctccaggatattacgtgtgcac
cggcgtgggatcctggaactggcaggaactgtgggttgtgttggtccccgaacccccatc
gcctatatgaaatatggttgcttttgtggcttgggaggccatggccagccccgcgatgcc
attgactggtgctgccatggccacgactgttgttacactcgagctgaggaggccggctgc
agccccaagacagagcgctactcctggcagtgcgtcaatcagagcgtcctgtgcggaccg
gcagagaacaaatgccaagaactgttgtgcaagtgtgaccaggagattgctaactgctta
gcccaaactgagtacaacttaaagtacctcttctacccccagttcctatgtgagccggac
tcgcccaagtgtgactga

KEGG   Homo sapiens (human): 84647
Entry
84647             CDS       T01001                                 

Gene name
PLA2G12B, FKSG71, GXIIB, GXIIIsPLA2, PLA2G13, sPLA2-GXIIB
Definition
(RefSeq) phospholipase A2 group XIIB
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    84647 (PLA2G12B)
   00565 Ether lipid metabolism
    84647 (PLA2G12B)
   00590 Arachidonic acid metabolism
    84647 (PLA2G12B)
   00591 Linoleic acid metabolism
    84647 (PLA2G12B)
   00592 alpha-Linolenic acid metabolism
    84647 (PLA2G12B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    84647 (PLA2G12B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    84647 (PLA2G12B)
  09154 Digestive system
   04972 Pancreatic secretion
    84647 (PLA2G12B)
   04975 Fat digestion and absorption
    84647 (PLA2G12B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    84647 (PLA2G12B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     84647 (PLA2G12B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    84647 (PLA2G12B)
SSDB
Motif
Pfam: PLA2G12
Other DBs
NCBI-GeneID: 84647
NCBI-ProteinID: NP_115951
OMIM: 611653
HGNC: 18555
Ensembl: ENSG00000138308
Vega: OTTHUMG00000018446
Pharos: Q9BX93(Tdark)
UniProt: Q9BX93
LinkDB
Position
10q22.1
AA seq 195 aa
MKLASGFLVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGK
NGVCQYRCRYGKAPMPRPGYKPQEPNGCGSYFLGLKVPESMDLGIPAMTKCCNQLDVCYD
TCGANKYRCDAKFRWCLHSICSDLKRSLGFVSKVEAACDSLVDTVFNTVWTLGCRPFMNS
QRAACICAEEEKEEL
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaagctggccagtggcttcttggttttgtggctcagccttgggggtggcctggctcag
agcgacacgagccctgacacggaggagtcctattcagactggggccttcggcacctccgg
ggaagctttgaatccgtcaatagctacttcgattcttttctggagctgctgggagggaag
aatggagtctgtcagtacaggtgccgatatggaaaggcaccaatgcccagacctggctac
aagccccaagagcccaatggctgcggctcctatttcctgggtctcaaggtaccagaaagt
atggacttgggcattccagcaatgacaaagtgctgcaaccagctggatgtctgttatgac
acttgcggtgccaacaaatatcgctgtgatgcaaaattccgatggtgtctccactcgatc
tgctctgaccttaagcggagtctgggctttgtctccaaagtggaagcagcctgtgattcc
ctggttgacactgtgttcaacaccgtgtggaccttgggctgccgcccctttatgaatagt
cagcgggcagcttgcatctgtgcagaggaggagaaggaagagttatga

KEGG   Homo sapiens (human): 8605
Entry
8605              CDS       T01001                                 

Gene name
PLA2G4C, CPLA2-gamma
Definition
(RefSeq) phospholipase A2 group IVC
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    8605 (PLA2G4C)
   00565 Ether lipid metabolism
    8605 (PLA2G4C)
   00590 Arachidonic acid metabolism
    8605 (PLA2G4C)
   00591 Linoleic acid metabolism
    8605 (PLA2G4C)
   00592 alpha-Linolenic acid metabolism
    8605 (PLA2G4C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    8605 (PLA2G4C)
   04010 MAPK signaling pathway
    8605 (PLA2G4C)
   04370 VEGF signaling pathway
    8605 (PLA2G4C)
   04072 Phospholipase D signaling pathway
    8605 (PLA2G4C)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    8605 (PLA2G4C)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    8605 (PLA2G4C)
   04664 Fc epsilon RI signaling pathway
    8605 (PLA2G4C)
   04666 Fc gamma R-mediated phagocytosis
    8605 (PLA2G4C)
  09152 Endocrine system
   04912 GnRH signaling pathway
    8605 (PLA2G4C)
   04913 Ovarian steroidogenesis
    8605 (PLA2G4C)
   04921 Oxytocin signaling pathway
    8605 (PLA2G4C)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    8605 (PLA2G4C)
  09156 Nervous system
   04724 Glutamatergic synapse
    8605 (PLA2G4C)
   04726 Serotonergic synapse
    8605 (PLA2G4C)
   04730 Long-term depression
    8605 (PLA2G4C)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    8605 (PLA2G4C)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    8605 (PLA2G4C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     8605 (PLA2G4C)
SSDB
Motif
Pfam: PLA2_B
Other DBs
NCBI-GeneID: 8605
NCBI-ProteinID: NP_003697
OMIM: 603602
HGNC: 9037
Ensembl: ENSG00000105499
Vega: OTTHUMG00000183185
Pharos: Q9UP65(Tchem)
UniProt: Q9UP65 A0A024QZH0
LinkDB
Position
19q13.33
AA seq 541 aa
MGSSEVSIIPGLQKEEKAAVERRRLHVLKALKKLRIEADEAPVVAVLGSGGGLRAHIACL
GVLSEMKEQGLLDAVTYLAGVSGSTWAISSLYTNDGDMEALEADLKHRFTRQEWDLAKSL
QKTIQAARSENYSLTDFWAYMVISKQTRELPESHLSNMKKPVEEGTLPYPIFAAIDNDLQ
PSWQEARAPETWFEFTPHHAGFSALGAFVSITHFGSKFKKGRLVRTHPERDLTFLRGLWG
SALGNTEVIREYIFDQLRNLTLKGLWRRAVANAKSIGHLIFARLLRLQESSQGEHPPPED
EGGEPEHTWLTEMLENWTRTSLEKQEQPHEDPERKGSLSNLMDFVKKTGICASKWEWGTT
HNFLYKHGGIRDKIMSSRKHLHLVDAGLAINTPFPLVLPPTREVHLILSFDFSAGDPFET
IRATTDYCRRHKIPFPQVEEAELDLWSKAPASCYILKGETGPVVMHFPLFNIDACGGDIE
AWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYYPKDSARSCCL
A
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgggaagctctgaagtttccataattcctgggctccagaaagaagaaaaggcggccgtg
gagagacgaagacttcatgtgctgaaagctctgaagaagctaaggattgaggctgatgag
gccccagttgttgctgtgctgggctcaggcggaggactgcgggctcacattgcctgcctt
ggggtcctgagtgagatgaaagaacagggcctgttggatgccgtcacgtacctcgcaggg
gtctctggatccacttgggcaatatcttctctctacaccaatgatggtgacatggaagct
ctcgaggctgacctgaaacatcgatttacccgacaggagtgggacttggctaagagccta
cagaaaaccatccaagcagcgaggtctgagaattactctctgaccgacttctgggcctac
atggttatctctaagcaaaccagagaactgccggagtctcatttgtccaatatgaagaag
cccgtggaagaagggacactaccctacccaatatttgcagccattgacaatgacctgcaa
ccttcctggcaggaggcaagagcaccagagacctggttcgagttcacccctcaccacgct
ggcttctctgcactgggggcctttgtttccataacccacttcggaagcaaattcaagaag
ggaagactggtcagaactcaccctgagagagacctgactttcctgagaggtttatgggga
agtgctcttggtaacactgaagtcattagggaatacatttttgaccagttaaggaatctg
accctgaaaggtttatggagaagggctgttgctaatgctaaaagcattggacaccttatt
tttgcccgattactgaggctgcaagaaagttcacaaggggaacatcctcccccagaagat
gaaggcggtgagcctgaacacacctggctgactgagatgctcgagaattggaccaggacc
tccctggaaaagcaggagcagccccatgaggaccccgaaaggaaaggctcactcagtaac
ttgatggattttgtgaagaaaacaggcatttgcgcttcaaagtgggaatgggggaccact
cacaacttcctgtacaaacacggtggcatccgggacaagataatgagcagccggaagcac
ctccacctggtggatgctggtttagccatcaacactcccttcccactcgtgctgcccccg
acgcgggaggttcacctcatcctctccttcgacttcagtgccggagatcctttcgagacc
atccgggctaccactgactactgccgccgccacaagatcccctttccccaagtagaagag
gctgagctggatttgtggtccaaggcccccgccagctgctacatcctgaaaggagaaact
ggaccagtggtgatgcattttcccctgttcaacatagatgcctgtggaggtgatattgag
gcatggagtgacacatacgacacattcaagcttgctgacacctacactctagatgtggtg
gtgctactcttggcattagccaagaagaatgtcagggaaaacaagaagaagatccttaga
gagttgatgaacgtggccgggctctactacccgaaggatagtgcccgaagttgctgcttg
gcatag

KEGG   Homo sapiens (human): 8681
Entry
8681              CDS       T01001                                 

Gene name
JMJD7-PLA2G4B, HsT16992, cPLA2-beta
Definition
(RefSeq) JMJD7-PLA2G4B readthrough
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    8681 (JMJD7-PLA2G4B)
   00565 Ether lipid metabolism
    8681 (JMJD7-PLA2G4B)
   00590 Arachidonic acid metabolism
    8681 (JMJD7-PLA2G4B)
   00591 Linoleic acid metabolism
    8681 (JMJD7-PLA2G4B)
   00592 alpha-Linolenic acid metabolism
    8681 (JMJD7-PLA2G4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    8681 (JMJD7-PLA2G4B)
   04010 MAPK signaling pathway
    8681 (JMJD7-PLA2G4B)
   04370 VEGF signaling pathway
    8681 (JMJD7-PLA2G4B)
   04072 Phospholipase D signaling pathway
    8681 (JMJD7-PLA2G4B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    8681 (JMJD7-PLA2G4B)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    8681 (JMJD7-PLA2G4B)
   04664 Fc epsilon RI signaling pathway
    8681 (JMJD7-PLA2G4B)
   04666 Fc gamma R-mediated phagocytosis
    8681 (JMJD7-PLA2G4B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    8681 (JMJD7-PLA2G4B)
   04913 Ovarian steroidogenesis
    8681 (JMJD7-PLA2G4B)
   04921 Oxytocin signaling pathway
    8681 (JMJD7-PLA2G4B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    8681 (JMJD7-PLA2G4B)
  09156 Nervous system
   04724 Glutamatergic synapse
    8681 (JMJD7-PLA2G4B)
   04726 Serotonergic synapse
    8681 (JMJD7-PLA2G4B)
   04730 Long-term depression
    8681 (JMJD7-PLA2G4B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    8681 (JMJD7-PLA2G4B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    8681 (JMJD7-PLA2G4B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     8681 (JMJD7-PLA2G4B)
SSDB
Motif
Pfam: Cupin_8 PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 8681
NCBI-ProteinID: NP_001185517
HGNC: 34449
Ensembl: ENSG00000168970
Vega: OTTHUMG00000044442
Pharos: P0C869(Tchem)
UniProt: P0C869
LinkDB
Position
15q15.1
AA seq 893 aa
MAEAALEAVRSELREFPAAARELCVPLAVPYLDKPPTPLHFYRDWVCPNRPCIIRNALQH
WPALQKWSLPYFRATVGSTEVSVAVTPDGYADAVRGDRFMMPAERRLPLSFVLDVLEGRA
QHPGVLYVQKQCSNLPSELPQLLPDLESHVPWASEALGKMPDAVNFWLGEAAAVTSLHKD
HYENLYCVVSGEKHFLFHPPSDRPFIPYELYTPATYQLTEEGTFKVVDEEAMEKAEVSRT
CLLTVRVLQAHRLPSKDLVTPSDCYVTLWLPTACSHRLQTRTVKNSSSPVWNQSFHFRIH
RQLKNVMELKVFDQDLVTGDDPVLSVLFDAGTLRAGEFRRESFSLSPQGEGRLEVEFRLQ
SLADRGEWLVSNGVLVARELSCLHVQLEETGDQKSSEHRVQLVVPGSCEGPQEASVGTGT
FRFHCPACWEQELSIRLQDAPEEQLKAPLSALPSGQVVRLVFPTSQEPLMRVELKKEAGL
RELAVRLGFGPCAEEQAFLSRRKQVVAAALRQALQLDGDLQEDEIPVVAIMATGGGIRAM
TSLYGQLAGLKELGLLDCVSYITGASGSTWALANLYEDPEWSQKDLAGPTELLKTQVTKN
KLGVLAPSQLQRYRQELAERARLGYPSCFTNLWALINEALLHDEPHDHKLSDQREALSHG
QNPLPIYCALNTKGQSLTTFEFGEWCEFSPYEVGFPKYGAFIPSELFGSEFFMGQLMKRL
PESRICFLEGIWSNLYAANLQDSLYWASEPSQFWDRWVRNQANLDKEQVPLLKIEEPPST
AGRIAEFFTDLLTWRPLAQATHNFLRGLHFHKDYFQHPHFSTWKATTLDGLPNQLTPSEP
HLCLLDVGYLINTSCLPLLQPTRDVDLILSLDYNLHGAFQGSGGHPRRRQLGR
NT seq 2682 nt   +upstreamnt  +downstreamnt
atggcggaggcggctttggaagccgtgcggagcgagttacgagaattcccggccgctgca
agggagctctgcgtgcctcttgctgtgccctacctggacaaacccccaactccgctccac
ttctaccgggactgggtctgccccaacaggccgtgcattatccgcaacgctctgcagcac
tggccggccctccagaagtggtccctcccctatttcagagccacagtgggctccacagag
gtgagtgtggccgtgaccccagatggttacgcggatgccgtgagaggggatcgcttcatg
atgccagctgagcgccgcctgcccctgagcttcgtgctggatgtgctggagggccgggcc
cagcaccctggagtcctctatgtgcagaagcagtgctccaacctgcccagcgagctgccc
cagctgctgcctgatctggaatcccatgtgccctgggcctccgaagccctgggaaagatg
cccgatgctgtgaacttctggctgggggaggcggctgcagtgacttctttgcacaaggac
cactatgagaacctctactgcgtggtctcaggagagaagcatttcctgttccatccgccc
agcgaccggcccttcatcccctatgagctgtacacgccggcaacctaccagctaactgaa
gagggcacctttaaggtggtggatgaagaggccatggagaaggcagaggtgtccaggacc
tgcctgctcacggttcgtgtcctgcaggcccatcgcctaccctctaaggacctagtgacc
ccctctgactgctacgtgactctctggctgcccacggcctgcagccacaggctccagaca
cgcacggtcaagaacagcagtagccctgtctggaaccagagctttcacttcaggatccac
aggcagctcaagaatgtcatggaactgaaagtctttgaccaggacctggtgaccggagat
gaccctgtgttgtcagtactgtttgatgcggggactctgcgggctggggagttccggcgc
gagagcttctcactgagccctcagggtgaggggcgcctggaagttgaatttcgcctgcag
agtctggctgaccgtggcgagtggctcgtcagcaatggcgttctggtggcccgggagctc
tcctgcttgcacgttcaactggaggagacaggagaccagaagtcctcagagcacagagtt
cagcttgtggttcctgggtcctgtgagggtccgcaggaggcctctgtgggcactggcacc
ttccgcttccactgcccagcctgctgggagcaggagctgagtattcgcctgcaggatgcc
cccgaggagcaactaaaggcgccactgagtgccctgccctctggtcaagtggtgaggctt
gtcttccccacgtcccaggagcccctgatgagagtggagctgaaaaaagaagcaggactg
agggagctggccgtgcgactgggcttcgggccctgtgcagaggagcaggccttcctgagc
aggaggaagcaggtggtggccgcggccttgaggcaggccctgcagctggacggagacctg
caggaggatgagatcccagtggtagctattatggccactggtggtgggatccgggcaatg
acttccctgtatgggcagctggctggcctgaaggagctgggcctcttggattgcgtctcc
tacatcaccggggcctcgggctccacctgggccttggccaacctttatgaggacccagag
tggtctcagaaggacctggcagggcccactgagttgctgaagacccaggtgaccaagaac
aagctgggtgtgctggcccccagccagctgcagcggtaccggcaggagctggccgagcgt
gcccgcttgggctacccaagctgcttcaccaacctgtgggccctcatcaacgaggcgctg
ctgcatgatgagccccatgatcacaagctctcagatcaacgggaggccctgagtcatggc
cagaaccctctgcccatctactgtgccctcaacaccaaagggcagagcctgaccactttt
gaatttggggagtggtgcgagttctctccctacgaggtcggcttccccaagtacggggcc
ttcatcccctctgagctctttggctccgagttctttatggggcagctgatgaagaggctt
cctgagtcccgcatctgcttcttagaaggtatctggagcaacctgtatgcagccaacctc
caggacagcttatactgggcctcagagcccagccagttctgggaccgctgggtcaggaac
caggccaacctggacaaggagcaggtcccccttctgaagatagaagaaccaccctcaaca
gccggcaggatagctgagtttttcaccgatcttctgacgtggcgtccactggcccaggcc
acacataatttcctgcgtggcctccatttccacaaagactactttcagcatcctcacttc
tccacatggaaagctaccactctggatgggctccccaaccagctgacaccctcggagccc
cacctgtgcctgctggatgttggctacctcatcaataccagctgcctgcccctcctgcag
cccactcgggacgtggacctcatcctgtcattggactacaacctccacggagccttccag
gggtccggcggacacccgaggaggcggcagctggggaggtga

DBGET integrated database retrieval system