KEGG   Homo sapiens (human): 10015Help
Entry
10015             CDS       T01001                                 

Gene name
PDCD6IP, AIP1, ALIX, DRIP4, HP95
Definition
(RefSeq) programmed cell death 6 interacting protein
  KO
K12200  programmed cell death 6-interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    10015 (PDCD6IP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10015 (PDCD6IP)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10015 (PDCD6IP)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT associated proteins
    10015 (PDCD6IP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   10015 (PDCD6IP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BRO1 ALIX_LYPXL_bnd Ly49
Motif
Other DBs
NCBI-GeneID: 10015
NCBI-ProteinID: NP_037506
OMIM: 608074
HGNC: 8766
Ensembl: ENSG00000170248
Vega: OTTHUMG00000130751
Pharos: Q8WUM4(Tbio)
UniProt: Q8WUM4
LinkDB All DBs
Structure
PDB: 

Position
3p22.3
AA seq 868 aa AA seqDB search
MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDK
HEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEK
SCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDIS
PDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKE
VFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDF
SDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVP
VSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTK
SRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTP
SNELYKPLRAEGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPA
KTMQGSEVVNVLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALS
VTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLREEVLKNLATAY
DNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERDELLKDLQQSIAREPSAP
SIPTPAYQSSPAGGHAPTPPTPAPRTMPPTKPQPPARPPPPVLPANRAPSATAPSPVGAG
TAAPAPSQTPGSAPPPQAQGPPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMPYPPVYHQS
PGQAPYPGPQQPSYPFPQPPQQSYYPQQ
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atggcgacattcatctcggtgcagctgaaaaagacctcagaggtggacctggccaagccg
ctggtgaagttcatccagcagacttacccaagcggcggggaagagcaggcccagtactgc
cgcgcggcggaggagctcagcaagctgcgccgcgccgcagtcggtcgtccgctggacaag
cacgagggcgcgctcgagacgctcctgagatattatgatcagatttgttctattgaaccc
aaattcccattttctgaaaatcagatctgcttgacatttacctggaaggatgctttcgat
aaaggttcactttttggaggctctgtaaaactggctcttgcaagcttaggatatgaaaag
agctgtgtgttgttcaattgtgcagccttagctagccaaattgcagcagaacagaacctg
gataatgatgaaggattgaaaatcgctgctaaacattaccagtttgctagtggtgccttt
ttacatattaaagagacggttttatctgccttaagtcgagagccgaccgtggacatatct
ccagatactgttgggaccctcagtcttattatgctggcacaggctcaagaagtatttttt
ttaaaagccacaagagataaaatgaaagatgccatcatagctaaattggctaatcaggct
gcagattattttggtgatgctttcaaacagtgtcaatacaaagatactctccccaaggag
gtgttccctgtcttggctgcaaagcactgtatcatgcaggccaatgctgagtaccatcag
tctatcctggcaaaacagcagaagaaatttggagaagaaattgcaaggttacagcatgca
gcagaactgattaaaacagtggcatctcgctatgatgaatatgttaatgtgaaggatttt
tctgacaaaatcaatcgtgcccttgctgcagcaaagaaggataatgacttcatttatcat
gatcgagttccagaccttaaagatctagatcctattggcaaagccacacttgtgaaatct
accccggtcaatgtacccatcagtcagaaatttactgatctgtttgagaagatggttccc
gtgtcagtacagcagtctttggctgcctataatcagaggaaagccgatttggttaacaga
tcaattgctcagatgagagaagccaccactttggcaaatggggtgctagcttcccttaat
cttccagcagcaattgaagatgtgtctggagacactgtacctcagtctatattgactaaa
tccagatctgtgattgaacagggaggcatccagactgttgatcagttgattaaagaactg
cctgaattactgcaacgaaatagagaaatcctagatgagtcattaaggttgttggatgaa
gaagaagcaaccgataatgatttaagagcaaaatttaaggaacgttggcaaaggacacca
tccaatgaactgtataagcctttaagagcagagggaaccaacttcagaacagttttagat
aaagctgtgcaggcagatggacaagtgaaagaatgttaccagtctcatcgtgacaccatc
gtgcttttgtgtaagccagagcctgagctgaatgctgccatcccttctgctaatccagca
aagaccatgcagggcagtgaggttgtaaatgtcttaaaatccttattgtcaaatcttgat
gaagtaaagaaggaaagagagggtctggagaatgacttgaaatctgtgaattttgacatg
acaagcaagtttttgacagccctggctcaagatggtgtgataaatgaagaagctctttct
gttactgaactagatcgagtctatggaggtcttacaactaaagtccaagaatctctaaag
aaacaggagggacttcttaaaaatattcaggtctcacatcaggaattttcaaaaatgaaa
caatctaataatgaagctaacttaagagaagaagttttgaagaatttagctactgcatat
gacaactttgttgaacttgtagctaatttgaaggaaggcacaaagttttacaatgagttg
actgaaatcctggtcaggttccagaacaaatgcagtgatatagtttttgcacggaagaca
gaaagagatgaactcttaaaggacttgcaacaaagcattgccagagaacctagtgctcct
tcaattcctacacctgcgtatcagtcctcaccagcaggaggacatgcaccaactcctcca
actccagcgccaagaaccatgccgcctactaagccccagcccccagccaggcctccacca
cctgtgcttccagcaaatcgagctccttctgctactgctccatctccagtgggggctggg
actgctgcgccagctccatcacaaacgcctggctcagctcctcctccacaggcgcaggga
ccaccctatcccacctatccaggatatcctgggtattgccaaatgcccatgcccatgggc
tataatccttatgcgtatggccagtataatatgccatatccaccagtgtatcaccagagt
cctggacaggctccatacccgggaccccagcagccttcataccccttccctcagccccca
cagcagtcttactatccacagcagtaa

DBGET integrated database retrieval system