KEGG   Homo sapiens (human): 10018Help
Entry
10018             CDS       T01001                                 

Gene name
BCL2L11, BAM, BIM, BOD
Definition
(RefSeq) BCL2 like 11
  KO
K16341  Bcl-2-like protein 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04068  FoxO signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05210  Colorectal cancer
Network
nt06131  Apoptosis (virus)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
nt06231  Apoptosis
nt06260  Colorectal cancer
nt06267  Small cell lung cancer
  Element
N00098  Intrinsic apoptotic pathway
N00262  EBV EBNA3C to intrinsic apoptotic pathway
N00474  EBV BHRF1 to intrinsic apoptotic pathway
N00585  HSV US3 to intrinsic apoptotic pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    10018 (BCL2L11)
   04151 PI3K-Akt signaling pathway
    10018 (BCL2L11)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    10018 (BCL2L11)
   04215 Apoptosis - multiple species
    10018 (BCL2L11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    10018 (BCL2L11)
   05206 MicroRNAs in cancer
    10018 (BCL2L11)
  09162 Cancer: specific types
   05210 Colorectal cancer
    10018 (BCL2L11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    10018 (BCL2L11)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    10018 (BCL2L11)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    10018 (BCL2L11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bim_N Bclx_interact
Motif
Other DBs
NCBI-GeneID: 10018
NCBI-ProteinID: NP_619527
OMIM: 603827
HGNC: 994
Ensembl: ENSG00000153094
Vega: OTTHUMG00000131256
Pharos: O43521(Tbio)
UniProt: O43521
LinkDB All DBs
Structure
PDB: 

Position
2q13
AA seq 198 aa AA seqDB search
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSP
QGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPP
CQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPR
MVILRLLRYIVRLVWRMH
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcaaccttctgatgtaagttctgagtgtgaccgagaaggtagacaattgcag
cctgcggagaggcctccccagctcagacctggggcccctacctccctacagacagagcca
caaggtaatcctgaaggcaatcacggaggtgaaggggacagctgcccccacggcagccct
cagggcccgctggccccacctgccagccctggcccttttgctaccagatccccgcttttc
atctttatgagaagatcctccctgctgtctcgatcctccagtgggtatttctcttttgac
acagacaggagcccagcacccatgagttgtgacaaatcaacacaaaccccaagtcctcct
tgccaggccttcaaccactatctcagtgcaatggcttccatgaggcaggctgaacctgca
gatatgcgcccagagatatggatcgcccaagagttgcggcgtattggagacgagtttaac
gcttactatgcaaggagggtatttttgaataattaccaagcagccgaagaccacccacga
atggttatcttacgactgttacgttacattgtccgcctggtgtggagaatgcattga

DBGET integrated database retrieval system