KEGG   Homo sapiens (human): 10018
Entry
10018             CDS       T01001                                 

Gene name
BCL2L11, BAM, BIM, BOD
Definition
(RefSeq) BCL2 like 11
  KO
K16341  Bcl-2-like protein 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04068  FoxO signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04932  Non-alcoholic fatty liver disease
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05210  Colorectal cancer
Network
nt06131  Apoptosis (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
nt06231  Apoptosis
nt06260  Colorectal cancer
nt06267  Small cell lung cancer
nt06414  Apoptosis
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00098  Intrinsic apoptotic pathway
N00262  EBV EBNA3C to intrinsic apoptotic pathway
N00474  EBV BHRF1 to intrinsic apoptotic pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    10018 (BCL2L11)
   04151 PI3K-Akt signaling pathway
    10018 (BCL2L11)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    10018 (BCL2L11)
   04215 Apoptosis - multiple species
    10018 (BCL2L11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    10018 (BCL2L11)
   05206 MicroRNAs in cancer
    10018 (BCL2L11)
  09162 Cancer: specific types
   05210 Colorectal cancer
    10018 (BCL2L11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    10018 (BCL2L11)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    10018 (BCL2L11)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    10018 (BCL2L11)
SSDB
Motif
Pfam: Bim_N Bclx_interact
Other DBs
NCBI-GeneID: 10018
NCBI-ProteinID: NP_619527
OMIM: 603827
HGNC: 994
Ensembl: ENSG00000153094
Vega: OTTHUMG00000131256
Pharos: O43521(Tbio)
UniProt: O43521
LinkDB
Structure
PDB: 

Position
2q13
AA seq 198 aa
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSP
QGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPP
CQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPR
MVILRLLRYIVRLVWRMH
NT seq 597 nt   +upstreamnt  +downstreamnt
atggcaaagcaaccttctgatgtaagttctgagtgtgaccgagaaggtagacaattgcag
cctgcggagaggcctccccagctcagacctggggcccctacctccctacagacagagcca
caaggtaatcctgaaggcaatcacggaggtgaaggggacagctgcccccacggcagccct
cagggcccgctggccccacctgccagccctggcccttttgctaccagatccccgcttttc
atctttatgagaagatcctccctgctgtctcgatcctccagtgggtatttctcttttgac
acagacaggagcccagcacccatgagttgtgacaaatcaacacaaaccccaagtcctcct
tgccaggccttcaaccactatctcagtgcaatggcttccatgaggcaggctgaacctgca
gatatgcgcccagagatatggatcgcccaagagttgcggcgtattggagacgagtttaac
gcttactatgcaaggagggtatttttgaataattaccaagcagccgaagaccacccacga
atggttatcttacgactgttacgttacattgtccgcctggtgtggagaatgcattga

KEGG   Homo sapiens (human): 27113
Entry
27113             CDS       T01001                                 

Gene name
BBC3, JFY-1, JFY1, PUMA
Definition
(RefSeq) BCL2 binding component 3
  KO
K10132  Bcl-2-binding component 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04390  Hippo signaling pathway
hsa05016  Huntington disease
hsa05162  Measles
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
Network
nt06131  Apoptosis (viruses and bacteria)
nt06140  Transcription (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06231  Apoptosis
nt06260  Colorectal cancer
nt06267  Small cell lung cancer
nt06414  Apoptosis
nt06440  Transcription
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00098  Intrinsic apoptotic pathway
N00695  MV V to p73-mediated transcription
N00982  Mutation-caused aberrant Htt to p53-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    27113 (BBC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    27113 (BBC3)
   04215 Apoptosis - multiple species
    27113 (BBC3)
   04115 p53 signaling pathway
    27113 (BBC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    27113 (BBC3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    27113 (BBC3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    27113 (BBC3)
  09172 Infectious disease: viral
   05162 Measles
    27113 (BBC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    27113 (BBC3)
SSDB
Other DBs
NCBI-GeneID: 27113
NCBI-ProteinID: NP_001120712
OMIM: 605854
HGNC: 17868
Ensembl: ENSG00000105327
Vega: OTTHUMG00000183489
Pharos: Q9BXH1(Tbio)
UniProt: Q96PG8 Q9BXH1
LinkDB
Position
19q13.32
AA seq 261 aa
MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLP
ARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAP
RPAPGRSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGG
RPQRTVRAAETRGAAAAPPLTLEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDS
GGRPLPPPDTLASAGDFLCTM
NT seq 786 nt   +upstreamnt  +downstreamnt
atgaaatttggcatggggtctgcccaggcatgtccatgccaggtgcccagggctgcttcc
acgacgtgggtcccctgccagatttgtggccccagggagcgccatggcccgcgcacgcca
ggagggcagctccccggagcccgtagagggcctggcccgcgacggcccgcgccccttccc
gctcggccgcctggtgccctcggcagtgtcctgcggcctctgcgagcccggcctggctgc
cgcccccgccgcccccaccctgctgcccgctgcctacctctgcgcccccaccgccccacc
cgccgtcaccgccgccctggggggttcccgctggcctgggggtccccgcagccggccccg
aggcccgcgcccggacggtcctcagccctcgctctcgctggcggagcagcacctggagtc
gcccgtgcccagcgccccgggggctctggcgggcggtcccacccaggcggccccgggagt
ccgcggggaggaggaacagtgggcccgggagatcggggcccagctgcggcggatggcgga
cgacctcaacgcacagtacgagcggcggagacaagaggagcagcagcggcaccgcccctc
accctggagggtcctgtacaatctcatcatgggactcctgcccttacccaggggccacag
agcccccgagatggagcccaattaggtgcctgcacccgcccggtggacgtcagggactcg
gggggcaggcccctcccacctcctgacaccctggccagcgcgggggactttctctgcacc
atgtag

KEGG   Homo sapiens (human): 5366
Entry
5366              CDS       T01001                                 

Gene name
PMAIP1, APR, NOXA
Definition
(RefSeq) phorbol-12-myristate-13-acetate-induced protein 1
  KO
K10131  phorbol-12-myristate-13-acetate-induced protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05210  Colorectal cancer
Network
nt06131  Apoptosis (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
nt06231  Apoptosis
nt06260  Colorectal cancer
nt06267  Small cell lung cancer
nt06414  Apoptosis
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00098  Intrinsic apoptotic pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    5366 (PMAIP1)
   04215 Apoptosis - multiple species
    5366 (PMAIP1)
   04115 p53 signaling pathway
    5366 (PMAIP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5366 (PMAIP1)
   05203 Viral carcinogenesis
    5366 (PMAIP1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    5366 (PMAIP1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    5366 (PMAIP1)
SSDB
Motif
Pfam: PMAIP1
Other DBs
NCBI-GeneID: 5366
NCBI-ProteinID: NP_066950
OMIM: 604959
HGNC: 9108
Ensembl: ENSG00000141682
Vega: OTTHUMG00000132765
Pharos: Q13794(Tbio)
UniProt: Q13794 A0A0S2Z490
LinkDB
Structure
PDB: 
3MQP

Position
18q21.32
AA seq 54 aa
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
NT seq 165 nt   +upstreamnt  +downstreamnt
atgcctgggaagaaggcgcgcaagaacgctcaaccgagccccgcgcgggctccagcagag
ctggaagtcgagtgtgctactcaactcaggagatttggagacaaactgaacttccggcag
aaacttctgaatctgatatccaaactcttctgctcaggaacctga

KEGG   Homo sapiens (human): 637
Entry
637               CDS       T01001                                 

Gene name
BID, FP497
Definition
(RefSeq) BH3 interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04071  Sphingolipid signaling pathway
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04650  Natural killer cell mediated cytotoxicity
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05416  Viral myocarditis
Network
nt06131  Apoptosis (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06231  Apoptosis
nt06263  Hepatocellular carcinoma
nt06414  Apoptosis
nt06460  Alzheimer disease
  Element
N00146  Crosstalk between extrinsic and intrinsic apoptotic pathways
N00449  HIV Tat/Nef to crosstalk between extrinsic and intrinsic apoptotic pathways
N00477  EBV BHRF1 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00526  HCV NS3 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00527  HCV Core to crosstalk between extrinsic and intrinsic apoptotic pathways
N01005  Mutation-caused aberrant Abeta to crosstalk between extrinsic and intrinsic apoptotic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    637 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    637 (BID)
   04215 Apoptosis - multiple species
    637 (BID)
   04217 Necroptosis
    637 (BID)
   04115 p53 signaling pathway
    637 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    637 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    637 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    637 (BID)
   05014 Amyotrophic lateral sclerosis
    637 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    637 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    637 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    637 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    637 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    637 (BID)
   05161 Hepatitis B
    637 (BID)
   05160 Hepatitis C
    637 (BID)
   05164 Influenza A
    637 (BID)
   05162 Measles
    637 (BID)
   05168 Herpes simplex virus 1 infection
    637 (BID)
   05163 Human cytomegalovirus infection
    637 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    637 (BID)
   05169 Epstein-Barr virus infection
    637 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    637 (BID)
SSDB
Motif
Pfam: BID Bcl-2 CRM1_C
Other DBs
NCBI-GeneID: 637
NCBI-ProteinID: NP_001187
OMIM: 601997
HGNC: 1050
Ensembl: ENSG00000015475
Vega: OTTHUMG00000150087
Pharos: P55957(Tbio)
UniProt: P55957 A8ASI8 B3KT21
LinkDB
Structure
PDB: 

Position
22q11.21
AA seq 195 aa
MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTD
GNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSE
EDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQ
NLRTYVRSLARNGMD
NT seq 588 nt   +upstreamnt  +downstreamnt
atggactgtgaggtcaacaacggttccagcctcagggatgagtgcatcacaaacctactg
gtgtttggcttcctccaaagctgttctgacaacagcttccgcagagagctggacgcactg
ggccacgagctgccagtgctggctccccagtgggagggctacgatgagctgcagactgat
ggcaaccgcagcagccactcccgcttgggaagaatagaggcagattctgaaagtcaagaa
gacatcatccggaatattgccaggcacctcgcccaggtcggggacagcatggaccgtagc
atccctccgggcctggtgaacggcctggccctgcagctcaggaacaccagccggtcggag
gaggaccggaacagggacctggccactgccctggagcagctgctgcaggcctaccctaga
gacatggagaaggagaagaccatgctggtgctggccctgctgctggccaagaaggtggcc
agtcacacgccgtccttgctccgtgatgtctttcacacaacagtgaattttattaaccag
aacctacgcacctacgtgaggagcttagccagaaatgggatggactga

DBGET integrated database retrieval system