KEGG   Homo sapiens (human): 10025Help
Entry
10025             CDS       T01001                                 

Gene name
MED16, DRIP92, THRAP5, TRAP95
Definition
(RefSeq) mediator complex subunit 16
  KO
K15159  mediator of RNA polymerase II transcription subunit 16
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    10025 (MED16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    10025 (MED16)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Tail
     10025 (MED16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med16 WD40 ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 10025
NCBI-ProteinID: NP_005472
OMIM: 604062
HGNC: 17556
Ensembl: ENSG00000175221
Vega: OTTHUMG00000181841
Pharos: Q9Y2X0(Tbio)
UniProt: Q9Y2X0
LinkDB All DBs
Position
19p13.3
AA seq 877 aa AA seqDB search
MCDLRRPAAGGMMDLAYVCEWEKWSKSTHCPSVPLACAWSCRNLIAFTMDLRSDDQDLTR
MIHILDTEHPWDLHSIPSEHHEAITCLEWDQSGSRLLSADADGQIKCWSMADHLANSWES
SVGSLVEGDPIVALSWLHNGVKLALHVEKSGASSFGEKFSRVKFSPSLTLFGGKPMEGWI
AVTVSGLVTVSLLKPSGQVLTSTESLCRLRGRVALADIAFTGGGNIVVATADGSSASPVQ
FYKVCVSVVSEKCRIDTEILPSLFMRCTTDLNRKDKFPAITHLKFLARDMSEQVLLCASS
QTSSIVECWSLRKEGLPVNNIFQQISPVVGDKQPTILKWRILSATNDLDRVSAVALPKLP
ISLTNTDLKVASDTQFYPGLGLALAFHDGSVHIVHRLSLQTMAVFYSSAAPRPVDEPAMK
RPRTAGPAVHLKAMQLSWTSLALVGIDSHGKLSVLRLSPSMGHPLEVGLALRHLLFLLEY
CMVTGYDWWDILLHVQPSMVQSLVEKLHEEYTRQTAALQQVLSTRILAMKASLCKLSPCT
VTRVCDYHTKLFLIAISSTLKSLLRPHFLNTPDKSPGDRLTEICTKITDVDIDKVMINLK
TEEFVLDMNTLQALQQLLQWVGDFVLYLLASLPNQGSLLRPGHSFLRDGTSLGMLRELMV
VIRIWGLLKPSCLPVYTATSDTQDSMSLLFRLLTKLWICCRDEGPASEPDEALVDECCLL
PSQLLIPSLDWLPASDGLVSRLQPKQPLRLQFGRAPTLPGSAATLQLDGLARAPGQPKID
HLRRLHLGACPTEECKACTRCGCVTMLKSPNRTTAVKQWEQRWIKNCLAVEGRGPDACVT
SRASEEAPAFVQLGPQSTHHSPRTPRSLDHLHPEDRP
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgatttgcggcggccagcggcaggtgggatgatggacttggcctacgtctgtgag
tgggagaaatggtccaagagcacccactgcccatcggtgcccctggcctgcgcctggtcc
tgccgaaatctcatcgccttcaccatggacctgcgcagcgatgaccaggacctgacccgc
atgatccacatcctggacacggagcacccctgggacctgcactcgatcccctcagagcac
cacgaggccatcacctgcctggagtgggaccagtcaggctcccggctcctgtcagcagat
gccgacgggcagatcaagtgctggagcatggcggaccacctggctaatagctgggagagc
tcagtgggcagcctagtggagggggaccccattgtggccctgtcctggctgcacaatggt
gtgaaactggccctgcacgtggagaagtcgggcgcctccagcttcggggagaagttctcc
cgagtcaagttctcaccgtcgctcacgctgttcggcggcaagcccatggagggctggatc
gcggtgacggtcagcggcctggtcaccgtgtccctgctgaagcccagcgggcaggtgctg
acgtccaccgagagcctgtgccggctgcgcggccgcgtggccctggccgacatcgccttc
accggcggcggcaacatcgtggtggccacggcggacggcagcagcgcgtcgcccgtgcag
ttctacaaggtgtgcgtgagcgtggtgagcgagaagtgccgtatcgacacggagatcctg
ccctccctgttcatgcgctgcaccaccgacctcaaccgcaaggacaagtttcccgccatc
acccacctcaagttcctggcccgggacatgtcggagcaggtgcttttgtgcgcgtccagc
cagaccagcagcatcgtggagtgctggtccctgcgcaaggagggactccccgtgaacaac
atcttccagcagatctcccccgtggttggcgacaaacagcccacaattctcaaatggcgg
atcctatcggccaccaacgatctggaccgtgtgtcggccgtggcgctgcccaagctgccc
atctcgctcaccaacaccgacctcaaggtggccagcgacacacagttctaccctggcctc
gggctggccctggccttccacgacggcagcgtccacatcgtgcaccggctctcactgcag
accatggccgtcttctacagctccgcggccccgaggcctgtggatgagccggccatgaag
cgcccccgcaccgcgggccccgccgtccacttaaaggctatgcagctatcgtggacgtca
ctggccctggtggggattgacagccacgggaagctgagcgtgctccgcctctcaccttcc
atgggccacccgctggaggtggggctggcgctgcggcacctgctcttcctgctggagtac
tgcatggtgaccggctacgactggtgggacatcctgctgcacgtgcagcccagtatggta
cagagcctggtggagaagctgcacgaggagtacacgcgccagaccgctgccctgcagcag
gtcctctccacccggatcctggccatgaaggcctcgctctgcaagctgtcgccctgcacg
gtgacccgcgtgtgcgactaccacaccaagctcttcctcatcgccatcagctccaccctg
aagtcgctgctgcgcccccactttctcaacacgcctgacaagagccccggcgaccggctg
accgagatctgcaccaagatcaccgacgtcgacattgacaaggtcatgatcaacctcaag
acggaggaatttgtgctggacatgaacacactgcaggcgctgcagcagctcttgcagtgg
gtgggcgacttcgtgctgtacctgctggccagcctacccaaccagggttccctgctgagg
ccgggccacagctttctgcgggacggcacctcgctgggcatgcttcgggaattgatggtg
gtcatccgcatctggggccttctgaagcccagctgcctgcccgtgtatacggccacctcg
gatacccaggacagcatgtccctgctcttccgcctgctcaccaagctctggatctgctgt
cgcgatgagggcccagcgagcgagccggacgaggcgctggtggatgaatgctgcctgctg
cccagccagctgcttatccccagcctggactggctgccagccagcgacggcctggttagc
cgcctgcagcccaagcagccccttcgtctgcagtttggccgggcgcccacgctgcctggc
agtgctgccaccctgcagctcgacggcctcgccagggccccaggccagcccaagatcgac
cacctgcggaggctgcaccttggcgcttgccccacggaggaatgcaaggcctgcaccagg
tgcggctgtgtcaccatgctcaagtcgcccaacagaaccacggcggtgaagcagtgggag
cagcgctggatcaagaactgcctggctgttgaaggccgtgggccggacgcctgcgtgacc
agcagagcttctgaggaagcccctgcctttgtccagctgggcccgcagtccacacaccac
tctcccaggacccccagatccctggaccatctgcatccagaggaccgtccgtga

KEGG   Homo sapiens (human): 116931Help
Entry
116931            CDS       T01001                                 

Gene name
MED12L, NOPAR, TNRC11L, TRALP, TRALPUSH
Definition
(RefSeq) mediator complex subunit 12L
  KO
K15162  mediator of RNA polymerase II transcription subunit 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    116931 (MED12L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    116931 (MED12L)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    CDK-module
     116931 (MED12L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med12-LCEWAV Med12-PQL Med12
Motif
Other DBs
NCBI-GeneID: 116931
NCBI-ProteinID: NP_443728
OMIM: 611318
HGNC: 16050
Ensembl: ENSG00000144893
Vega: OTTHUMG00000159844
Pharos: Q86YW9(Tbio)
UniProt: Q86YW9 B3KXY0
LinkDB All DBs
Position
3q25.1
AA seq 2145 aa AA seqDB search
MAAFGLLSYEQRPLKRPRLGPPDVYPQDPKQKEDELTAVNVKQGFNNQPAFTGDEHGSAR
NIVINPSKIGAYFSSILAEKLKLNTFQDTGKKKPQVNAKDNYWLVTARSQSAIHSWFSDL
AGNKPLSILAKKVPILSKKEDVFAYLAKYSVPMVRATWLIKMTCAYYSAISEAKIKKRQA
PDPNLEWTQISTRYLREQLAKISDFYHMASSTGDGPVPVPPEVEQAMKQWEYNEKLAFHM
FQEGMLEKHEYLTWILDVLEKIRPMDDDLLKLLLPLMLQYSDEFVQSAYLSRRLAYFCAR
RLSLLLSDSPNLLAAHSPHMMIGPNNSSIGAPSPGPPGPGMSPVQLAFSDFLSCAQHGPL
VYGLSCMLQTVTLCCPSALVWNYSTNENKSANPGSPLDLLQVAPSSLPMPGGNTAFNQQV
RARIYEVEQQIKQRGRAVEVRWSFDKCQESTAGVTISRVLHTLEVLDRHCFDRTDSSNSM
ETLYHKIFWANQNKDNQEVAPNDEAVVTLLCEWAVSCKRSGKHRAMAVAKLLEKRQAEIE
AERCGESEVLDEKESISSSSLAGSSLPVFQNVLLRFLDTQAPSLSDPNSECEKVEFVNLV
LLFCEFIRHDVFSHDAYMCTLISRGDLSVTASTRPRSPVGENADEHYSKDHDVKMEIFSP
MPGESCENANTSLGRRMSVNCEKLVKREKPRELIFPSNYDLLRHLQYATHFPIPLDESSS
HECNQRTILLYGVGKERDEARHQLKKITKDILKILNKKSTTETGVGDEGQKARKNKQETF
PTLETVFTKLQLLSYFDQHQVTSQISNNVLEQITSFASGTSYHLPLAHHIQLIFDLMEPA
LNINGLIDFAIQLLNELSVVEAELLLKSSSLAGSYTTGLCVCIVAVLRRYHSCLILNPDQ
TAQVFEGLCGVVKHVVNPSECSSPERCILAYLYDLYVSCSHLRSKFGDLFSSACSKVKQT
IYNNVMPANSNLRWDPDFMMDFIENPSARSINYSMLGKILSDNAANRYSFVCNTLMNVCM
GHQDAGRINDIANFSSELTACCTVLSSEWLGVLKALCCSSNHVWGFNDVLCTVDVSDLSF
HDSLATFIAILIARQCFSLEDVVQHVALPSLLAAACGDADAEPGARMTCRLLLHLFRAPQ
ACFLPQATGKPFPGIRSSCDRHLLAAAHNSIEVGAVFAVLKAIMMLGDAKIGNNSVSSLK
NDDFTMRGLRCDGNADDIWTASQNPKSCGKSISIETANLREYARYVLRTICQQEWVGEHC
LKEPERLCTDKELILDPVLSNMQAQKLLQLICYPHGIKECTEGDNLQRQHIKRILQNLEQ
WTLRQSWLELQLMIKQCLKDPGSGSVAEMNNLLDNIAKATIEVFQQSADLNNSSNSGMSL
FNPNSIGSADTSSTRQNGIKTFLSSSERRGVWLVAPLIARLPTSVQGRVLKAAGEELEKG
QHLGSSSKKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLQNQVNQILSNW
REERYQDDIKARQMMHEALQLRLNLVGGMFDTVQRSTQWTTDWALLLLQIITSGTVDMHT
NNELFTTVLDMLGVLINGTLASDLSNASPGGSEENKRAYMNLVKKLKKELGDKRSESIDK
VRQLLPLPKQTCDVITCEPMGSLIDTKGNKIAGFDSIDKKQGLQVSTKQKVSPWDLFEGQ
KNPAPLSWAWFGTVRVDRRVIKYEEQHHLLLYHTHPMPKPRSYYLQPLPLPPEEEEEEPT
SPVSQEPERKSAELSDQGKTTTDEEKKTKGRKRKTKSSSRVDEYPQSNIYRVPPNYSPIS
SQMMHHPQSTLWGYNLVGQPQQPGFFLQNQSLTPGGSRLDPAGSFVPTNTKQALSNMLQR
RSGAMMQPPSLHAITSQQQLIQMKLLQQQQQQRLLRQAQTRPFQQGQPGDQAALFAAQAR
PSPQLPQYPGLQQAQTMPQGYTMYGTQMPLQQTSQQQAGSVVLSPSYNSRAYPAAHSNPV
LMERLRQIQQQPSGYVQQQASPYLQPLTGSQRLNHQALQQSPLVGGGIDAVLTSAHPNLP
SVPLPQDPMRPRQPQVRQQQRLLQMQQPQQPQPQQPPQPQQSSQSQSQTLGLQAMQPQQP
LFPRQGLQQTQQQQQTAALVRQLQKQLSSNQPQQGVTPYGHPSHF
NT seq 6438 nt NT seq  +upstreamnt  +downstreamnt
atggccgccttcgggcttctcagctatgagcagagaccgctgaagcgcccccggctcggg
ccgcccgacgtctacccacaggaccccaagcagaaggaggatgaacttactgctgtgaat
gtaaagcaaggcttcaataatcagccagccttcactggagatgaacatggctcagccaga
aatattgtaattaacccatcaaagattggagcttattttagcagcatattagctgagaaa
ctgaagcttaacactttccaggacacgggaaagaagaaaccacaagttaatgctaaagat
aattattggctggttactgctcgatcccagagtgcaattcatagttggttttctgactta
gcaggaaataagccactttctattttggcaaaaaaggttcctatccttagtaaaaaagag
gatgtttttgcatatttagctaaatattctgtgccaatggttcgagcaacgtggctgatc
aagatgacttgtgcctattattctgctatatctgaagctaaaattaagaaacgtcaggct
cctgatccgaatttggagtggacacagatatctaccagatatcttcgagagcagttggcc
aagatttctgacttttaccacatggcctccagcacgggcgatggccctgtccctgtgcca
ccagaggtggagcaagccatgaagcaatgggaatacaacgaaaagctagcatttcacatg
ttccaggaaggaatgttagaaaaacacgaatatttgacatggatcctggatgttttagaa
aagatcagaccaatggatgatgatcttcttaaactcttgctaccactaatgctgcagtat
tcagatgagtttgttcagtcggcctacctgtctcgtcgtcttgcctacttttgtgcccgg
cgtctttccttgctgctgagcgatagccccaacctccttgctgcccactcaccccacatg
atgataggaccaaacaactcgagtatcggggcccccagccctggcccccccggccctggc
atgagccccgtgcagctggccttctcagattttctttcctgtgcacagcatggtcccctg
gtttatggacttagttgtatgttgcagactgtcactctctgttgcccaagtgccttggtg
tggaattattccacaaatgaaaataagagcgcaaacccaggctcacccctggatctgctg
caggtggccccgtccagcctccccatgccgggtgggaacacggctttcaatcagcaggtt
cgggcaaggatttatgaagtagaacaacagataaaacaaagaggccgtgcagtggaagtt
cggtggtcatttgacaagtgccaagaatccacagcaggggtgactattagtcgggttttg
cacacgttggaagttttggatcgtcactgttttgaccgaactgattccagcaattccatg
gagacactttatcataagattttctgggcaaaccaaaacaaagataaccaagaggttgcg
cccaacgatgaagctgtggtgacgctgttatgtgaatgggccgtgagctgcaaacggtct
ggcaagcacagggccatggctgtggcaaaactcctggagaagaggcaagcagaaattgag
gcagagagatgtggtgaatcagaagtcttagatgagaaggagtctatttcttcatcctct
cttgctggatccagtttgcctgttttccagaatgtgctgttaaggtttttagatacacag
gccccctctttgtcggacccaaacagtgaatgtgaaaaggtggaatttgtgaacctggtg
ctgctcttctgcgagttcatccgccatgatgtcttctcccatgacgcatacatgtgtacc
ctcatatctcgaggagatttgtcagtcactgcctcaactcggccgcggtcaccagtaggg
gaaaatgcagatgaacactattcaaaggaccatgatgtgaaaatggagattttttctcct
atgcctggagaatcctgtgagaatgccaacacttcgttgggcagaagaatgtcagttaat
tgtgagaagttggtgaagagggaaaagccaagggaattaatttttccatctaattatgac
ctccttcgccacttacagtatgcaacacattttcctatacctctggatgaatcttcaagt
catgaatgtaaccagcgcacaatccttctctatggagtcggcaaagagcgtgatgaagca
aggcatcagctgaagaagattaccaaagatatcctgaaaattctaaataagaagagcacc
acagagacaggggttggggacgaaggacaaaaagccaggaagaacaaacaggagacattt
ccaacactggagactgtgttcactaaactccagctcctttcatattttgatcaacatcaa
gtgacatctcagatttctaacaatgtgctagaacaaatcacaagctttgcgtcaggaaca
tcctatcatctccctttggctcaccacattcagctcatctttgatctcatggagccagca
ctgaacatcaacggactaattgacttcgcaatacagttactaaatgaactgagtgttgtg
gaagctgaactgctcctaaaatcctccagcctggcaggaagttatacaacaggactgtgt
gtctgcatcgtggctgttctcaggcgctatcacagttgtctaatcttgaatcctgatcag
acagcccaggtgtttgaagggttgtgtggtgtggtcaagcatgtcgtaaacccctcagaa
tgttcttcccctgaaagatgcattttagcctacctctatgatctctatgtgtcatgtagc
cacctcagaagtaaatttggagacctcttcagtagtgcctgttcaaaagtaaagcaaacc
atatataataacgtgatgcctgcaaattcgaacttgcgatgggatccagacttcatgatg
gattttattgagaatccctcagcccgcagcatcaactactcaatgctgggcaagatcctc
agtgacaatgcggccaatcgctacagctttgtctgcaatacactcatgaatgtatgtatg
ggccatcaggatgctggcaggattaacgacatagccaatttctcctctgagcttacggct
tgctgcactgttcttagttcagaatggctgggggttctgaaggctctttgttgttcttca
aatcacgtgtgggggtttaatgatgtactttgcactgtagatgtgagtgacctttcattc
catgattcattagctactttcattgctattctgatagcacgacagtgtttttccctggag
gacgtcgtgcagcatgtcgcacttccctctcttctagcagcagcttgtggggatgcggac
gccgagcctggggcgagaatgacatgccgactcttgcttcatctcttccgagctccccag
gcctgcttcttacctcaagcaacgggcaaacctttccctggaataagatcatcttgtgat
agacacctcttagccgctgctcacaacagcattgaagtgggagccgtgtttgctgtctta
aaagcaattatgatgcttggagatgccaaaattggcaataacagtgtcagctctttaaag
aatgatgacttcaccatgagaggtttgcgatgtgatgggaatgctgatgatatctggact
gcctcacaaaatccaaaatcctgtgggaaaagcatttccatagaaactgccaatttaaga
gaatacgctagatatgtactgaggactatctgtcaacaggaatgggtaggagagcattgc
ttaaaagaacctgaaagattatgtacagacaaagaacttatattggaccctgtgctttca
aatatgcaagcacagaaattactgcagcttatctgttatcctcatggcattaaagaatgt
accgagggggacaatctgcaaagacagcacattaagcgtattcttcagaatcttgagcag
tggacactgaggcaatcctggttagaactccagctaatgatcaaacagtgcttgaaggac
cctggctctggttctgtggccgaaatgaacaacttactggacaatattgcaaaggcaaca
atagaggtattccagcagtctgcagacctaaataattcttctaattctggcatgagcctc
ttcaacccaaacagtattggaagtgctgatacaagtagcacgagacagaatggaataaag
acattcctaagttcctccgaacgcaggggtgtatggttggtggcccccctcatcgccagg
ttgccaacttctgtgcaaggaagagtgctgaaagccgctggggaagagctggagaaggga
cagcacttgggttcttcttccaaaaaggaaagggacagacagaaacagaaaagtatgtct
cttttgagtcaacaacccttcctctcactggtacttacctgccttaagggacaagatgaa
caaagggaaggcctcctaacatctctccagaatcaagttaaccagattttaagtaactgg
agagaagaacgataccaagatgacataaaagcgcggcagatgatgcacgaagcattgcaa
ctccgcctaaatttggtaggaggaatgtttgacacggtgcagaggagcacccagtggact
acagactgggccctgctactccttcagatcattacttcaggaactgttgacatgcacact
aacaatgaattattcacaacagttcttgacatgctgggtgttttaatcaatggaacgtta
gcctctgacctatcaaatgcatcccctgggggatctgaagagaacaagcgtgcatacatg
aatttagtaaagaaactgaaaaaagagctaggagacaagcgatcagaaagtattgacaaa
gttcgacagttactacctttgccgaaacagacatgtgatgtcatcacttgtgaacctatg
ggttccttgattgacacaaaaggaaacaaaattgctggatttgactctatagataaaaaa
cagggtctccaggtctctacgaagcagaaggtgtccccgtgggacttgtttgagggtcag
aagaacccagctcctttgtcctgggcctggtttgggacagtccgagtggaccgaagagtg
atcaagtacgaggagcagcatcacctcctgctgtatcacacacaccccatgcccaagccc
cgcagttactacctccagccactgcccctgcctcctgaggaggaagaggaagagcccaca
tctccagtttctcaggaaccagaaaggaagtccgctgagctgtcagatcagggaaaaacc
acaacagatgaagaaaagaaaacaaaaggaaggaagcgcaagacgaaatctagctcaaga
gttgatgaatatccacagagcaacatataccgagtgcctcctaattactcgcctatctcc
tcccaaatgatgcaccatccacagtccaccttgtggggttacaacctcgtgggccagccc
cagcagcccggctttttccttcagaaccaatctcttactccaggtggctccagattggac
cctgcaggctcctttgtcccaaccaacaccaaacaagctctgtcaaacatgctacagcgg
cgctcaggcgccatgatgcagccgccttctcttcatgcaatcacatcgcagcagcagttg
atacagatgaagcttctgcagcagcagcagcaacagcgacttctcaggcaagcccagact
cggcctttccaacagggccagccgggggaccaggctgctctctttgctgcgcaagcacgg
ccctcccctcagctccctcagtatccagggctgcagcaagcacagaccatgccacagggc
tatacaatgtatgggacacagatgcctttgcagcagacatcgcagcagcaggctggcagt
gtggtcctgtctcccagctataactccagagcctatccggccgcacattccaaccccgtg
ctaatggaaagactcagacagattcagcagcagccgagtggctatgttcagcagcaggcc
tcgccgtacctgcagcccctgactggctctcagagactgaaccatcaggctctacagcag
agccctctggtgggcgggggaattgatgctgtgctgacttctgcacatccaaaccttccc
tccgtgcccctgcctcaggatcccatgagacccagacagccgcaagttcgacagcagcag
agactcctccagatgcagcagccccagcagccccagccccagcagcctccccagccccag
cagtcctcgcagtcccagagtcagacccttggtctccaagcaatgcagccccagcagccc
ttgtttcccaggcaaggcttgcagcagacccagcagcagcagcagacggccgccttggtg
cggcagctccagaagcagctttccagcaaccagccacagcaaggagtgactccgtatggg
catccttcacacttctga

KEGG   Homo sapiens (human): 23389Help
Entry
23389             CDS       T01001                                 

Gene name
MED13L, MRFACD, PROSIT240, THRAP2, TRAP240L
Definition
(RefSeq) mediator complex subunit 13L
  KO
K15164  mediator of RNA polymerase II transcription subunit 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
Disease
H00550  Complete transposition of the great arteries
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    23389 (MED13L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    23389 (MED13L)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    CDK-module
     23389 (MED13L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med13_C MID_MedPIWI Med13_N
Motif
Other DBs
NCBI-GeneID: 23389
NCBI-ProteinID: NP_056150
OMIM: 608771
HGNC: 22962
Ensembl: ENSG00000123066
Vega: OTTHUMG00000169404
Pharos: Q71F56(Tbio)
UniProt: Q71F56
LinkDB All DBs
Position
12q24.21
AA seq 2210 aa AA seqDB search
MTAAANWVANGASLEDCHSNLFSLAELTGIKWRRYNFGGHGDCGPIISAPAQDDPILLSF
IRCLQANLLCVWRRDVKPDCKELWIFWWGDEPNLVGVIHHELQVVEEGLWENGLSYECRT
LLFKAIHNLLERCLMDKNFVRIGKWFVRPYEKDEKPVNKSEHLSCAFTFFLHGESNVCTS
VEIAQHQPIYLINEEHIHMAQSSPAPFQVLVSPYGLNGTLTGQAYKMSDPATRKLIEEWQ
YFYPMVLKKKEESKEEDELGYDDDFPVAVEVIVGGVRMVYPSAFVLISQNDIPVPQSVAS
AGGHIAVGQQGLGSVKDPSNCGMPLTPPTSPEQAILGESGGMQSAASHLVSQDGGMITMH
SPKRSGKIPPKLHNHMVHRVWKECILNRTQSKRSQMSTPTLEEEPASNPATWDFVDPTQR
VSCSCSRHKLLKRCAVGPNRPPTVSQPGFSAGPSSSSSLPPPASSKHKTAERQEKGDKLQ
KRPLIPFHHRPSVAEELCMEQDTPGQKLGLAGIDSSLEVSSSRKYDKQMAVPSRNTSKQM
NLNPMDSPHSPISPLPPTLSPQPRGQETESLDPPSVPVNPALYGNGLELQQLSTLDDRTV
LVGQRLPLMAEVSETALYCGIRPSNPESSEKWWHSYRLPPSDDAEFRPPELQGERCDAKM
EVNSESTALQRLLAQPNKRFKIWQDKQPQLQPLHFLDPLPLSQQPGDSLGEVNDPYTFED
GDIKYIFTANKKCKQGTEKDSLKKNKSEDGFGTKDVTTPGHSTPVPDGKNAMSIFSSATK
TDVRQDNAAGRAGSSSLTQVTDLAPSLHDLDNIFDNSDDDELGAVSPALRSSKMPAVGTE
DRPLGKDGRAAVPYPPTVADLQRMFPTPPSLEQHPAFSPVMNYKDGISSETVTALGMMES
PMVSMVSTQLTEFKMEVEDGLGSPKPEEIKDFSYVHKVPSFQPFVGSSMFAPLKMLPSHC
LLPLKIPDACLFRPSWAIPPKIEQLPMPPAATFIRDGYNNVPSVGSLADPDYLNTPQMNT
PVTLNSAAPASNSGAGVLPSPATPRFSVPTPRTPRTPRTPRGGGTASGQGSVKYDSTDQG
SPASTPSTTRPLNSVEPATMQPIPEAHSLYVTLILSDSVMNIFKDRNFDSCCICACNMNI
KGADVGLYIPDSSNEDQYRCTCGFSAIMNRKLGYNSGLFLEDELDIFGKNSDIGQAAERR
LMMCQSTFLPQVEGTKKPQEPPISLLLLLQNQHTQPFASLNFLDYISSNNRQTLPCVSWS
YDRVQADNNDYWTECFNALEQGRQYVDNPTGGKVDEALVRSATVHSWPHSNVLDISMLSS
QDVVRMLLSLQPFLQDAIQKKRTGRTWENIQHVQGPLTWQQFHKMAGRGTYGSEESPEPL
PIPTLLVGYDKDFLTISPFSLPFWERLLLDPYGGHRDVAYIVVCPENEALLEGAKTFFRD
LSAVYEMCRLGQHKPICKVLRDGIMRVGKTVAQKLTDELVSEWFNQPWSGEENDNHSRLK
LYAQVCRHHLAPYLATLQLDSSLLIPPKYQTPPAAAQGQATPGNAGPLAPNGSAAPPAGS
AFNPTSNSSSTNPAASSSASGSSVPPVSSSASAPGISQISTTSSSGFSGSVGGQNPSTGG
ISADRTQGNIGCGGDTDPGQSSSQPSQDGQESVTERERIGIPTEPDSADSHAHPPAVVIY
MVDPFTYAAEEDSTSGNFWLLSLMRCYTEMLDNLPEHMRNSFILQIVPCQYMLQTMKDEQ
VFYIQYLKSMAFSVYCQCRRPLPTQIHIKSLTGFGPAASIEMTLKNPERPSPIQLYSPPF
ILAPIKDKQTELGETFGEASQKYNVLFVGYCLSHDQRWLLASCTDLHGELLETCVVNIAL
PNRSRRSKVSARKIGLQKLWEWCIGIVQMTSLPWRVVIGRLGRLGHGELKDWSILLGECS
LQTISKKLKDVCRMCGISAADSPSILSACLVAMEPQGSFVVMPDAVTMGSVFGRSTALNM
QSSQLNTPQDASCTHILVFPTSSTIQVAPANYPNEDGFSPNNDDMFVDLPFPDDMDNDIG
ILMTGNLHSSPNSSPVPSPGSPSGIGVGSHFQHSRSQGERLLSREAPEELKQQPLALGYF
VSTAKAENLPQWFWSSCPQAQNQCPLFLKASLHHHISVAQTDELLPARNSQRVPHPLDSK
TTSDVLRFVLEQYNALSWLTCNPATQDRTSCLPVHFVVLTQLYNAIMNIL
NT seq 6633 nt NT seq  +upstreamnt  +downstreamnt
atgactgcggcagcgaactgggtggcgaacggggcgagcctggaggattgtcactccaac
ctcttttcgctggctgaactcacgggaatcaaatggcgtaggtacaattttggagggcat
ggggactgtggacccataatttcagccccagcccaagatgatccaattctgttaagtttc
atccgctgtctgcaagctaacctgctttgtgtatggcgtcgtgatgtcaaaccagattgc
aaagagttatggatattctggtggggagatgaacccaacctagtgggtgtaatacatcat
gaactgcaggttgtggaagaaggactctgggaaaatggcctttcctatgaatgtaggacg
ctgctcttcaaagcgatccacaatctgttagaaaggtgcctaatggataagaacttcgtt
aggattgggaaatggtttgtccgaccctacgaaaaggatgaaaagccagtcaacaaaagt
gagcatttgtcctgtgctttcacattctttctgcatggagaaagtaatgtatgcacaagt
gtggagattgcccagcaccagccaatttatttgatcaatgaggagcatatacacatggct
cagtcttcacctgcaccatttcaagtactggtaagtccttatggcttaaatgggacgcta
acaggccaagcatacaagatgtcagacccagccactcgtaagttgattgaggaatggcag
tatttctacccgatggtgctaaaaaagaaagaagaatcgaaagaggaagacgagttggga
tatgatgatgatttccctgtggcagttgaagtaattgttggtggtgttcggatggtttac
ccttcagcatttgttttgatctctcagaatgacatcccggttcctcagagtgttgccagt
gctggaggccacattgcagttgggcagcaagggcttggtagtgtgaaggacccaagtaac
tgtgggatgcctctgacccctcccacctctccagaacaggctatcctaggtgagagtgga
ggtatgcagagtgctgccagtcacctggtttcccaagatggagggatgataacgatgcac
agtccaaagagatcggggaagattcctccaaaactccacaatcatatggtccatcgagtc
tggaaggaatgcatcctcaacagaacccagtccaagaggagccaaatgtcaactccaact
cttgaagaagagcctgctagcaatcctgctacttgggattttgtggatccaacccaaaga
gtcagctgttcttgttccaggcataagcttttaaaacgttgtgcagtcgggcccaatcga
cctcccacagtatctcaaccagggttcagtgcaggaccatcatcatcttcatctttacca
cctcctgcttcttctaagcacaaaacagcagaaagacaggaaaaaggagacaagctgcaa
aagagacccttaataccatttcaccataggccctctgtggccgaagaattatgcatggag
caagatacaccaggacagaaactagggttggcagggatagactcctccttagaggtgtct
agcagtaggaaatatgataagcaaatggccgtgccttccagaaatacaagcaagcaaatg
aatctgaatcctatggattcacctcattcccctatatcccctctgccaccaacactcagc
cctcagccacgaggtcaggaaacagagagtttggacccaccatcggtccctgtgaatcca
gccctttatggaaatggactagaactccagcagttgtctactctggatgacagaactgtc
ctcgtaggccaaagactgcctctcatggcagaggtcagcgagacagccttatattgtggg
attaggccctcgaacccggagtcatcagaaaagtggtggcatagttatcgtctcccaccc
agtgatgatgctgagttcaggcctccagagctccagggtgagagatgtgatgccaaaatg
gaggtaaactcagagagcactgcattgcaaagactcttagcacaacctaacaaacggttt
aaaatctggcaagacaaacagccccagttgcagccactccacttccttgacccattgcct
ctatcacaacaacctggagacagtttgggagaagtgaatgacccatatacctttgaagat
ggtgacataaaatacatctttacagccaacaagaaatgcaaacaagggacggagaaagat
tccctgaaaaagaataagtcagaggatggatttggtaccaaggatgtcactacaccaggt
cattccacgccggtgcctgatgggaaaaatgccatgtctattttcagttctgctactaaa
acagatgtccggcaggataatgctgctggcagagctggctccagtagccttacacaggta
acagatttggcaccttccctgcatgacttagacaacatctttgataattctgatgacgac
gaacttggggctgtatcacctgctctgcgctcatcaaaaatgcctgcagttgggacagaa
gaccgacctcttgggaaggatggaagagctgctgttccttatccaccaacagttgcagac
ttgcaaaggatgtttcccactccaccatctttggaacagcatcctgcattttctcctgtg
atgaattataaagatgggatcagctcagagacagtgacagcattaggcatgatggagagc
cctatggtcagtatggtttcaacacaactcacagaattcaaaatggaagtggaagatgga
ttaggaagtcccaagcccgaggaaattaaggacttttcatatgtgcacaaagttccatcc
tttcaaccttttgtgggatcctccatgtttgctccactgaagatgttgccgagccattgt
ttgctacctctgaagatacctgatgcctgtctgtttcggccttcatgggcaattcctcct
aaaattgaacaactgcccatgccccctgcagccactttcattagagatggctacaataac
gtgcctagtgttgggagcctagcagatccagactatctgaacacaccacagatgaacaca
cccgtgacgttgaacagcgctgccccagccagcaatagtggggcaggagtcctaccatct
ccagcaacccctcgcttctctgtccccacaccacgaacccccaggaccccaagaactccc
agaggtgggggcactgccagtggtcaagggtctgttaagtatgatagcaccgatcaagga
tcaccagcctccaccccctctactacacggcccctcaactctgtggagcccgccaccatg
cagccaattcccgaagcccacagcctctatgttaccctgattctctccgattccgtgatg
aatatctttaaagacagaaactttgacagctgttgcatctgtgcctgcaacatgaacatc
aaaggggcggatgtcgggctttacatccccgattcttccaatgaggaccagtaccgctgt
acctgtgggtttagtgcgattatgaaccgcaaacttggctacaattcaggactcttcctt
gaagatgagttggatatttttgggaagaattctgatattggtcaggctgcagagaggcgc
ttaatgatgtgtcagtccaccttccttcctcaggtggaaggaaccaaaaaaccccaggag
ccacccataagccttctcctcctcctccagaatcaacacacacaaccttttgcttcactg
aatttcctggactacatttcctctaacaatcgccaaactcttccctgtgtaagctggagt
tatgaccgggtgcaagcagataataatgattactggacggaatgctttaatgcgttggag
caggggcggcagtatgtggataaccccactggtggaaaagtggacgaagctctggtgaga
agtgccactgtgcactcttggcctcacagcaatgtgctggacatcagcatgctctcctcc
caggatgtggttcgtatgctgttgtccctgcagccctttctccaagatgccatccaaaag
aagcgcacgggcaggacctgggagaacatccagcatgtgcagggaccactcacttggcag
cagttccataaaatggcaggacggggaacctacggttcggaagaatctcctgagccgttg
cccatccccactctgctggtaggctatgacaaggatttcctcaccatctcgccattctcc
ttgccgttttgggagaggctcttgttggacccatatgggggccaccgtgatgttgcctat
attgtggtgtgtccagaaaatgaggccttgctcgaaggagccaaaactttcttcagggac
ttgagtgctgtatacgagatgtgtaggcttgggcagcacaagcccatctgcaaagtgcta
cgtgacgggatcatgcgcgtgggaaaaactgtggcacagaagctgacagatgagcttgtg
agtgagtggtttaaccagccttggagcggcgaggagaatgacaatcattccagactcaaa
ctttatgcgcaagtttgccgccatcacctagcaccttatttagccactctgcagcttgat
agcagcctattgataccacctaaataccagaccccaccagcagcagcacagggacaagct
acgccagggaatgctgggcccttagctccaaatggatcagcagctcccccagctggcagt
gcatttaatcccacctcgaatagtagttctacaaatcctgcagcaagtagttctgcatct
ggttcctctgtgccaccggtctcatcgtctgcctctgctcctggtattagccagataagc
actacctcttcttcaggattcagtggtagtgttggagggcagaaccccagcactgggggc
atttctgcggatagaacgcaagggaacataggctgtggtggagacactgaccctgggcag
agctcttctcagccctcacaggatggacaagagagtgttacagaaagggagagaatagga
attcccacggagcctgactctgcagacagccatgcccaccctccagctgttgtcatttac
atggtggacccgttcacgtatgctgcagaggaggactccacttctgggaacttttggctg
ttgagcttgatgcgctgctacacagaaatgctggataatttacctgagcatatgagaaat
tctttcattctccagattgtgccttgccagtacatgctgcagacaatgaaggatgagcaa
gttttctacattcaatacttgaagtccatggcattttcagtgtactgccagtgcaggcga
ccactgcctacacagatccacattaaatccctcacgggatttgggcctgcagccagcatt
gagatgaccctcaagaaccctgagcggcccagcccaatccagctttactcccctcccttt
atattggccccaatcaaagacaagcagacagagctgggagagacgtttggtgaggcgagc
cagaaatacaatgtgctcttcgtgggctattgtctgtctcacgaccagcgctggcttttg
gcttcctgcactgacctccatggggaattattagagacctgcgttgtaaatattgcttta
ccaaacaggtcacggaggagtaaagtatctgcacgtaaaattggactacagaagttatgg
gagtggtgcatagggattgtccaaatgacatctctaccctggagagttgtaatcgggcga
cttgggcgtcttggccatggggagcttaaagattggagtatcctccttggagaatgttca
ctacagacaatcagcaaaaagctcaaggatgtgtgccggatgtgtggaatctctgccgca
gactctccttctatccttagtgcctgcctggttgccatggagccccaggggtcctttgta
gtgatgccagatgctgtcacaatgggctctgtttttggccgaagtactgcactgaacatg
cagtcatctcagctcaacacccctcaagatgcttcttgtacacacatcttggtgttccca
acatcatcaaccatccaggtggctccagccaactaccccaatgaagatgggtttagcccc
aacaatgatgatatgtttgttgaccttccattcccagatgatatggacaatgatattggc
atattaatgactgggaacctccattcctctcccaactcttccccagtaccctccccaggc
tctccttctggaattggtgtgggctctcacttccagcatagtcggagccagggtgagcgt
cttctttctagagaagcaccagaggagctaaagcagcagcccctggcccttgggtatttt
gtatcaactgccaaagctgagaatcttccccagtggttttggtcatcgtgtccccaggct
caaaaccagtgccctctcttcttaaaggcttcgctgcatcaccacatttcagtagcacag
acagacgaacttctgcctgccaggaattctcagcgggttccacaccctcttgactccaaa
accacgtcggatgttttaaggtttgttttggagcagtacaacgctctgtcctggctcacg
tgcaatccggccacccaggaccgtacttcctgccttcccgtccactttgtggtgctcact
cagttgtacaatgccatcatgaatatactttaa

KEGG   Homo sapiens (human): 29079Help
Entry
29079             CDS       T01001                                 

Gene name
MED4, ARC36, DRIP36, HSPC126, TRAP36, VDRIP
Definition
(RefSeq) mediator complex subunit 4
  KO
K15146  mediator of RNA polymerase II transcription subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    29079 (MED4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    29079 (MED4)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Middle
     29079 (MED4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med4 HMMR_N Mu-like_Pro ALIX_LYPXL_bnd Csm1_N DUF4094 AUDH_Cupin FAM76 Spc7 TRAF_BIRC3_bd Phage_GPO
Motif
Other DBs
NCBI-GeneID: 29079
NCBI-ProteinID: NP_054885
OMIM: 605718
HGNC: 17903
Ensembl: ENSG00000136146
Vega: OTTHUMG00000016891
Pharos: Q9NPJ6(Tbio)
UniProt: Q9NPJ6 A0A024RDY7
LinkDB All DBs
Position
13q14.2
AA seq 270 aa AA seqDB search
MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAG
EENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQI
LATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDL
EMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDF
LLEPPGHNKENEDDVEIMSTDSSSSSSESD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgtcttcgagtggtgagaaggagaaggagcggctgggaggcggtttgggagtg
gcgggtggtaacagcacacgagagcggctgctgtctgcgcttgaggacttggaggtcctg
tctagggaacttatagaaatgctggcaatttcaagaaaccaaaagttgttacaggctgga
gaggaaaaccaggtcctggagttgttaattcaccgagatggggaatttcaagaactaatg
aaattggcacttaatcagggaaaaattcatcatgaaatgcaagttttagaaaaagaagta
gagaagagagacagtgatattcagcagctacaaaaacagctaaaggaagcagaacaaata
ctggcaacagctgtttaccaagcgaaggagaaactcaagtcaatagaaaaagcaagaaaa
ggtgctatctcctctgaagaaataattaagtatgcacataggatcagtgcaagtaatgct
gtatgtgctccactgacctgggttccaggggacccccggagaccctacccaactgattta
gagatgagaagtgggttactgggtcagatgaacaatccttccactaatggcgtgaatggc
catttaccaggagatgcacttgcagcaggaagattgccagatgtccttgctccacagtat
ccatggcagtcaaatgacatgtcgatgaatatgttaccaccaaatcatagtagtgacttt
ttgttggaacctcctgggcataataaagaaaatgaagatgatgtagagattatgtcaacg
gactcctcaagcagtagtagtgagtctgattga

KEGG   Homo sapiens (human): 90390Help
Entry
90390             CDS       T01001                                 

Gene name
MED30, MED30S, THRAP6, TRAP25
Definition
(RefSeq) mediator complex subunit 30
  KO
K15143  mediator of RNA polymerase II transcription subunit 30
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    90390 (MED30)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    90390 (MED30)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Head
     90390 (MED30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med30 APG17 UPF0449 DUF4200 DUF948 NYD-SP28_assoc
Motif
Other DBs
NCBI-GeneID: 90390
NCBI-ProteinID: NP_542382
OMIM: 610237
HGNC: 23032
Ensembl: ENSG00000164758
Vega: OTTHUMG00000164920
Pharos: Q96HR3(Tbio)
UniProt: Q96HR3
LinkDB All DBs
Position
8q24.11
AA seq 178 aa AA seqDB search
MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQL
PNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEE
DGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgtccacccctccgttggccgcgtcggggatggcgcccgggcccttcgccgggccccag
gctcagcaggccgcccgggaagtcaacacggcgtcgctgtgccgcatcgggcaggagaca
gtgcaggacatcgtgtaccgcaccatggagatcttccagctcctgaggaacatgcagctg
ccaaatggtgtcacttaccacactggaacatatcaagaccggttaacaaagctacaggat
aatcttcgccaactttcagttctcttcaggaagctgagattggtatatgacaaatgcaat
gaaaactgtggtgggatggatcccattccagtcgagcaacttattccatatgtggaagaa
gatggctcaaagaatgatgatcgggctggcccacctcgttttgctagtgaagagaggcga
gaaattgctgaagtaaataaaaaactcaaacagaagaatcaacagctgaaacaaattatg
gatcaattacgaaatctcatctgggatataaatgccatgttggcaatgaggaactaa

KEGG   Homo sapiens (human): 9282Help
Entry
9282              CDS       T01001                                 

Gene name
MED14, CRSP150, CRSP2, CSRP, CXorf4, DRIP150, EXLM1, RGR1, TRAP170
Definition
(RefSeq) mediator complex subunit 14
  KO
K15156  mediator of RNA polymerase II transcription subunit 14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    9282 (MED14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    9282 (MED14)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Tail
     9282 (MED14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med14
Motif
Other DBs
NCBI-GeneID: 9282
NCBI-ProteinID: NP_004220
OMIM: 300182
HGNC: 2370
Ensembl: ENSG00000180182
Vega: OTTHUMG00000024107
Pharos: O60244(Tbio)
UniProt: O60244
LinkDB All DBs
Position
Xp11.4
AA seq 1454 aa AA seqDB search
MAPVQLENHQLVPPGGGGGGSGGPPSAPAPPPPGAAVAAAAAAAASPGYRLSTLIEFLLH
RAYSELMVLTDLLPRKSDVERKIEIVQFASRTRQLFVRLLALVKWANNAGKVEKCAMISS
FLDQQAILFVDTADRLASLARDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPP
DPITKIEKQATLHQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDD
PDVPWRLLKLEILVEDKETGDGRALVHSMQISFIHQLVQSRLFADEKPLQDMYNCLHSFC
LSLQLEVLHSQTLMLIRERWGDLVQVERYHAGKCLSLSVWNQQVLGRKTGTASVHKVTIK
IDENDVSKPLQIFHDPPLPASDSKLVERAMKIDHLSIEKLLIDSVHARAHQKLQELKAIL
RGFNANENSSIETALPALVVPILEPCGNSECLHIFVDLHSGMFQLMLYGLDQATLDDMEK
SVNDDMKRIIPWIQQLKFWLGQQRCKQSIKHLPTISSETLQLSNYSTHPIGNLSKNKLFI
KLTRLPQYYIVVEMLEVPNKPTQLSYKYYFMSVNAADREDSPAMALLLQQFKENIQDLVF
RTKTGKQTRTNAKRKLSDDPCPVESKKTKRAGEMCAFNKVLAHFVAMCDTNMPFVGLRLE
LSNLEIPHQGVQVEGDGFSHAIRLLKIPPCKGITEETQKALDRSLLDCTFRLQGRNNRTW
VAELVFANCPLNGTSTREQGPSRHVYLTYENLLSEPVGGRKVVEMFLNDWNSIARLYECV
LEFARSLPDIPAHLNIFSEVRVYNYRKLILCYGTTKGSSISIQWNSIHQKFHISLGTVGP
NSGCSNCHNTILHQLQEMFNKTPNVVQLLQVLFDTQAPLNAINKLPTVPMLGLTQRTNTA
YQCFSILPQSSTHIRLAFRNMYCIDIYCRSRGVVAIRDGAYSLFDNSKLVEGFYPAPGLK
TFLNMFVDSNQDARRRSVNEDDNPPSPIGGDMMDSLISQLQPPPQQQPFPKQPGTSGAYP
LTSPPTSYHSTVNQSPSMMHTQSPGNLHAASSPSGALRAPSPASFVPTPPPSSHGISIGP
GASFASPHGTLDPSSPYTMVSPSGRAGNWPGSPQVSGPSPAARMPGMSPANPSLHSPVPD
ASHSPRAGTSSQTMPTNMPPPRKLPQRSWAASIPTILTHSALNILLLPSPTPGLVPGLAG
SYLCSPLERFLGSVIMRRHLQRIIQQETLQLINSNEPGVIMFKTDALKCRVALSPKTNQT
LQLKVTPENAGQWKPDELQVLEKFFETRVAGPPFKANTLIAFTKLLGAPTHILRDCVHIM
KLELFPDQATQLKWNVQFCLTIPPSAPPIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEP
VSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNPPRQGECTIFAAVR
DLMANLTLPPGGRP
NT seq 4365 nt NT seq  +upstreamnt  +downstreamnt
atggccccagtgcagctggagaaccaccagctggtcccgcccggaggcggcggcgggggc
agcggcggacccccgtcagccccagcccctcctcccccgggagccgccgtggcggcggcc
gctgcagctgcggctagcccgggctaccggctgagcaccctcattgaatttctgctgcac
cgggcctactcggagcttatggtgttgacggacctactgccaaggaaatctgatgtggaa
aggaaaatagaaatagtgcagtttgctagccggacacgccaactcttcgttcgattatta
gctttagtgaaatgggctaataatgctggcaaagtggaaaaatgtgcgatgatttcaagc
tttttagatcagcaagccatcctgtttgtggacactgctgatcgcctggcctcgttagct
agagatgctctggtccatgcacgcctgcctagttttgccatcccatatgccattgatgta
ctaactactggatcttacccacggctgccaacctgcattagggacaaaattattcctcca
gacccaattaccaaaattgaaaaacaagccacactccatcagctgaatcagattcttaga
catcggcttgtaaccacagatcttcctcctcagttagcaaatcttacagttgcaaatggc
cgggtgaagtttcgtgttgaaggagaatttgaagccaccttgactgtgatgggagatgac
cctgatgttccatggcgtcttctcaagctagaaattctagttgaggataaggaaacagga
gatgggcgagctttggttcatagcatgcaaatcagcttcatccatcaactggtgcagtct
aggctctttgctgatgagaaacctcttcaggatatgtacaactgcctacattctttctgt
ttatcacttcagttagaagtgttacattcccaaactctaatgttaatccgagaacggtgg
ggagaccttgtgcaggtggaaaggtatcatgctggaaagtgcctctccctttcagtttgg
aatcaacaggttcttgggagaaaaactggaacagcatctgttcacaaagttacaattaaa
attgatgagaatgatgtctccaagcctttacagatttttcacgatcctcctttgccagct
tctgattccaaattagtagaaagagccatgaagatcgaccacttatcaatagaaaaactc
ctgattgacagtgtccatgcaagagctcatcagaagctccaagaactgaaggccattctt
agaggcttcaatgccaatgaaaactcttccatagagactgcactcccagctcttgttgtt
cccatcttggagccctgtggtaattcagagtgtctgcacatttttgtagatttacattct
ggaatgtttcaattgatgctttatggacttgaccaggccactctggatgacatggagaag
tctgtgaatgatgatatgaaacgaatcataccctggattcagcaacttaagttttggctt
ggacaacagcgttgcaagcagtctataaaacatctgcctacgataagcagtgaaacattg
cagctttccaattactcaactcatcctattggaaacctttctaagaataaactgttcatt
aaacttacccgccttccacaatactacattgttgtggagatgttggaggttcccaataaa
cccacacaactgtcgtacaagtactactttatgtctgtgaatgctgcagatcgtgaagac
agccctgcaatggcattgctgctgcagcagttcaaggaaaacattcaggacttggttttt
cgtacaaaaaccgggaaacagaccagaaccaatgccaagcgcaagttgtctgatgatcca
tgtccagtagaatccaagaaaacaaaacgagcaggagaaatgtgtgccttcaataaagtt
ttagcccacttcgtcgctatgtgtgatacaaatatgccatttgtaggacttcggttggag
ttgtccaatctggagattccacatcaaggagtgcaagtggaaggtgatggcttcagccat
gcaattcgcttattaaaaattcctccctgtaagggtataactgaggaaacccaaaaggct
ctggaccgctctcttcttgattgcactttccgattacaaggtagaaataaccgcacttgg
gtagcagagttagtgtttgcaaattgtccacttaatggcacttctactagggagcaagga
ccatcccggcacgtttacctgacatatgaaaatctgttgtctgagcctgttggtggtaga
aaggtggttgaaatgtttcttaatgactggaatagcattgcacgattatatgagtgtgtg
ttggaatttgcacgttctctaccagacatacctgctcatctaaatattttctcagaagtt
cgtgtttataattaccgaaaacttatcttgtgttatggaaccaccaagggaagctcaatt
agtatccaatggaattcgatccatcaaaaattccacatttctttgggaactgttggccca
aactcaggttgcagtaactgtcacaataccattctccatcagcttcaagaaatgttcaac
aaaacaccaaatgtggttcagttattacaggtactgtttgatactcaggctccattaaat
gccatcaacaaactccccactgtgccgatgttgggcttgacccagagaaccaatactgcc
taccagtgcttctccattctgccacagtcgtccacccacatcagactggccttcaggaac
atgtattgcattgatatatactgccggagtcgaggtgttgtggcaatacgggatggtgcc
tatagtctttttgataacagcaaactagttgaaggtttctatcctgcaccaggactaaag
acgttcctgaatatgtttgttgacagcaatcaggatgctcgaagaaggtctgtaaatgag
gacgataatcccccttctcctataggaggagatatgatggattctttaatatcgcagctc
cagccaccaccccagcaacagccatttccaaagcagccaggaacatcaggtgcttatcct
cttacttcaccccctacatcttatcatagcacagtcaatcagtctccctcaatgatgcac
acacagtctccaggaaatctgcatgctgccagctcccccagtggggctttgagagcccca
tcaccagcgtcatttgttccaactcctcccccatcctcgcatggaatctcaataggacca
ggggccagttttgctagtccacatggaactcttgaccctagttccccatacactatggtg
tcaccaagtggacgagcagggaactggccaggatctcctcaagtgtctggcccctcacca
gcagcacgcatgcctggaatgtcaccagccaacccctcactacattctccggttccagat
gcttctcattcccctcgagctggaacaagttctcaaacaatgccaacaaacatgcctcca
cctcgtaaactacctcagcgctcttgggcggcatccatacctaccatcctcactcacagt
gccttgaacattttactgctgccctctccaactccaggccttgtgcccggcctggcaggt
agttacctttgttctccacttgagagattccttggatcagtcatcatgagacgacatctt
caaagaattattcaacaagaaacgctgcagctgataaattctaatgaacccggagtgatc
atgtttaagactgatgcactgaaatgcagagtagctcttagtcccaaaaccaaccaaacg
cttcagctaaaagtgacacctgaaaatgcaggacagtggaaacctgatgaacttcaagtt
ttggagaaattctttgaaacaagagttgcaggaccaccatttaaagctaatacgttaata
gccttcaccaagctattaggagctcctacacacatcctcagggattgtgtgcacattatg
aagctggagctgttccctgaccaagcaacacagctaaaatggaatgttcagttttgcctg
acgatccctcccagcgcgccgccgattgcacctcctgggacgcctgctgtggtgctgaaa
tccaaaatgctattttttcttcaactaactcagaaaacatcggtccctccccaagaacct
gttagtattatagttccaatcatttatgacatggcttcaggtacaacccagcaggcagac
attcccagacagcagaactcttctgttgctgctcccatgatggtcagcaacattctgaag
aggtttgcagagatgaatccaccacgacaaggtgaatgcacaatatttgcagctgttcgt
gatttaatggctaatcttacactgccccctggtgggcgtccatag

KEGG   Homo sapiens (human): 9440Help
Entry
9440              CDS       T01001                                 

Gene name
MED17, CRSP6, CRSP77, DRIP80, SRB4, TRAP80
Definition
(RefSeq) mediator complex subunit 17
  KO
K15133  mediator of RNA polymerase II transcription subunit 17
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
Disease
H02132  Microcephaly syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    9440 (MED17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    9440 (MED17)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Head
     9440 (MED17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med17 Thioredoxin_12
Motif
Other DBs
NCBI-GeneID: 9440
NCBI-ProteinID: NP_004259
OMIM: 603810
HGNC: 2375
Ensembl: ENSG00000042429
Vega: OTTHUMG00000167497
Pharos: Q9NVC6(Tbio)
UniProt: Q9NVC6
LinkDB All DBs
Position
11q21
AA seq 651 aa AA seqDB search
MSGVRAVRISIESACEKQVHEVGLDGTETYLPPLSMSQNLARLAQRIDFSQGSGSEEEEA
AGTEGDAQEWPGAGSSADQDDEEGVVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVR
DKKFMTLDPVSQDALPPKQNPQTLQLISKKKSLAGAAQILLKGAERLTKSVTENQENKLQ
RDFNSELLRLRQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDLDLDKKIPEDY
CPLDVQIPSDLEGSAYIKVSIQKQAPDIGDLGTVNLFKRPLPKSKPGSPHWQTKLEAAQN
VLLCKEIFAQLSREAVQIKSQVPHIVVKNQIISQPFPSLQLSISLCHSSNDKKSQKFATE
KQCPEDHLYVLEHNLHLLIREFHKQTLSSIMMPHPASAPFGHKRMRLSGPQAFDKNEINS
LQSSEGLLEKIIKQAKHIFLRSRAAATIDSLASRIEDPQIQAHWSNINDVYESSVKVLIT
SQGYEQICKSIQLQLNIGVEQIRVVHRDGRVITLSYQEQELQDFLLSQMSQHQVHAVQQL
AKVMGWQVLSFSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGSKIMVQFPRNQ
CKDLPKSDVLQDNKWSHLRGPFKEVQWNKMEGRNFVYKMELLMSALSPCLL
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtccggggtgcgcgcagtgcggatcagcatcgaatcggcctgcgagaagcaggtccat
gaggtgggcctggatggcaccgagacgtacctgcccccgctgtccatgtcgcagaatctg
gcgcgtctggcccagcggatagacttcagccagggttcgggctccgaggaggaggaggcg
gcggggaccgagggcgacgcgcaggagtggccgggcgccgggtccagcgcagaccaggac
gacgaggaaggagtggtaaaatttcagccttccctttggccttgggactcagtgaggaac
aatttgagaagtgccctgacagagatgtgtgttctctatgatgttctcagtattgttagg
gataaaaaatttatgactcttgatcctgtctctcaggatgcacttcctccaaaacagaat
cctcagacgttgcaattgatatctaaaaagaagtcacttgctggagcagcacaaatctta
ttgaagggggcagaaagactgactaaatcagttaccgaaaaccaagaaaacaagctacaa
agagacttcaattctgagcttttgcgattacggcaacactggaaacttcgaaaagttgga
gataaaattctcggagatctgagctacagaagtgcaggatctctctttcctcatcatggt
acatttgaagtaataaagaatacagatctcgatctggataaaaagatacctgaagattac
tgtcctcttgatgtccaaattcctagtgatttagaggggtctgcatatatcaaggtttca
atacaaaaacaggctccagatataggtgacctcggcacagttaacctcttcaaacgacct
ttgcccaaatccaaaccaggttccccacattggcagacaaaattagaagcggcacagaat
gttctcttatgtaaagaaatttttgcacagctctctcgggaagctgttcaaattaaatca
caagtccctcacattgtggtgaaaaaccagattatctctcagccctttccgagcttgcag
ttatctatttctttgtgccattcctcaaatgataagaaatcccaaaaatttgctactgag
aagcaatgtccggaggaccacctttatgtcctagagcataatttgcatctactgattaga
gagtttcataaacagaccttgagttccatcatgatgcctcatccagcaagtgcacctttt
ggccacaagagaatgagactttcgggtcctcaagcttttgataaaaatgaaattaattca
ttacagtccagtgaagggcttctggaaaaaataattaaacaagcaaagcatatttttcta
aggagtagagctgctgcaaccattgacagcttagcaagccgaattgaggatcctcagata
caggctcattggtcaaatatcaatgatgtttatgaatctagtgtgaaagttttaatcaca
tcacaaggctatgaacaaatatgcaagtccattcaactgcaattgaatattggagttgag
cagattcgagttgtacatagagatggaagagtaattacactgtcttatcaggagcaggag
ctacaggattttcttctgtctcagatgtcacagcaccaggtacatgcagttcagcaactc
gccaaggttatgggctggcaagtactgagcttcagtaatcatgtgggacttggacctata
gagagcattggtaatgcatctgccatcacggtggcctccccaagtggtgactatgctatt
tcagttcgtaatggacctgaaagtggcagcaagattatggttcagtttcctcgtaaccaa
tgtaaagaccttccaaaaagtgatgttttacaagataacaaatggagtcatcttcgtggg
ccattcaaagaagttcagtggaataaaatggaaggtcgaaattttgtttataaaatggag
ctgcttatgtctgcacttagcccttgtctactatga

KEGG   Homo sapiens (human): 9442Help
Entry
9442              CDS       T01001                                 

Gene name
MED27, CRAP34, CRSP34, CRSP8, MED3, TRAP37
Definition
(RefSeq) mediator complex subunit 27
  KO
K15170  mediator of RNA polymerase II transcription subunit 27
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    9442 (MED27)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    9442 (MED27)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Other mediators
     9442 (MED27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med27
Motif
Other DBs
NCBI-GeneID: 9442
NCBI-ProteinID: NP_004260
OMIM: 605044
HGNC: 2377
Ensembl: ENSG00000160563
Vega: OTTHUMG00000020833
Pharos: Q6P2C8(Tbio)
UniProt: Q6P2C8 A0A024R8B7
LinkDB All DBs
Position
9q34.13
AA seq 311 aa AA seqDB search
MADVINVSVNLEAFSQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIAHFQDNL
HSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYH
AGLASGLLNQQSLKRSANQMGVSAKRRPKAQPTTLVLPPQYVDDVISRIDRMFPEMSIHL
SRPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNENVYTEDGKLDIWSKSNYQVFQ
KVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQAPCQRCGKFLQDGLPPTWRDFR
TLEAFHDTCRQ
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgtgataaatgtcagtgtgaacctggaggccttttcccaggccattagtgcc
atccaggcgctgcgctccagcgtgagcagggtgttcgactgcctgaaggatgggatgcgg
aacaaggagacgctggagggccgggagaaggcctttattgcgcacttccaggacaactta
cattcggtcaaccgggacctcaatgagctggaacgtctgagcaatctggtaggcaagcca
tctgagaaccatcctcttcataacagtgggctgttaagcctggatcctgtgcaggacaaa
actcctctctatagtcaactccttcaagcatataagtggtcaaacaagttgcagtaccat
gcaggactagcatctggccttttaaatcagcagtcattgaagcgttccgctaatcagatg
ggagtatctgccaaacgtagaccaaaggctcagcccacaactcttgtcctaccacctcaa
tatgttgatgatgtgatcagccgcattgacaggatgtttcctgaaatgtccatccactta
tccagacccaatggaacatcagcaatgcttctggtgaccttgggaaaggtgttgaaagtg
atcgtcgtcatgcggagcctgttcattgatcgaacaatagtaaagggatataacgagaat
gtctacacagaagatggcaagcttgatatatggtccaaatccaactatcaagtattccag
aaggtgacagaccatgccaccactgccctgctccactatcagctgccccagatgccggat
gtcgtggtccgatccttcatgacctggttaagaagttacataaagctgttccaggccccg
tgccagcgctgcgggaagtttctgcaggacggccttcccccgacatggagggatttccga
accctcgaagccttccatgacacctgccggcagtag

KEGG   Homo sapiens (human): 9862Help
Entry
9862              CDS       T01001                                 

Gene name
MED24, ARC100, CRSP100, CRSP4, DRIP100, MED5, THRAP4, TRAP100
Definition
(RefSeq) mediator complex subunit 24
  KO
K15167  mediator of RNA polymerase II transcription subunit 24
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    9862 (MED24)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    9862 (MED24)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Other mediators
     9862 (MED24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med24_N
Motif
Other DBs
NCBI-GeneID: 9862
NCBI-ProteinID: NP_055630
OMIM: 607000
HGNC: 22963
Ensembl: ENSG00000008838
Vega: OTTHUMG00000133329
Pharos: O75448(Tbio)
UniProt: O75448
LinkDB All DBs
Position
17q21.1
AA seq 989 aa AA seqDB search
MKVVNLKQAILQAWKERWSDYQWAINMKKFFPKGATWDILNLADALLEQAMIGPSPNPLI
LSYLKYAISSQMVSYSSVLTAISKFDDFSRDLCVQALLDIMDMFCDRLSCHGKAEECIGL
CRALLSALHWLLRCTAASAERLREGLEAGTPAAGEKQLAMCLQRLEKTLSSTKNRALLHI
AKLEEASSWTAIEHSLLKLGEILANLSNPQLRSQAEQCGTLIRSIPTMLSVHAEQMHKTG
FPTVHAVILLEGTMNLTGETQSLVEQLTMVKRMQHIPTPLFVLEIWKACFVGLIESPEGT
EELKWTAFTFLKIPQVLVKLKKYSHGDKDFTEDVNCAFEFLLKLTPLLDKADQRCNCDCT
NFLLQECGKQGLLSEASVNNLMAKRKADREHAPQQKSGENANIQPNIQLILRAEPTVTNI
LKTMDADHSKSPEGLLGVLGHMLSGKSLDLLLAAAAATGKLKSFARKFINLNEFTTYGSE
ESTKPASVRALLFDISFLMLCHVAQTYGSEVILSESRTGAEVPFFETWMQTCMPEEGKIL
NPDHPCFRPDSTKVESLVALLNNSSEMKLVQMKWHEACLSISAAILEILNAWENGVLAFE
SIQKITDNIKGKVCSLAVCAVAWLVAHVRMLGLDEREKSLQMIRQLAGPLFSENTLQFYN
ERVVIMNSILERMCADVLQQTATQIKFPSTGVDTMPYWNLLPPKRPIKEVLTDIFAKVLE
KGWVDSRSIHIFDTLLHMGGVYWFCNNLIKELLKETRKEHTLRAVELLYSIFCLDMQQVT
LVLLGHILPGLLTDSSKWHSLMDPPGTALAKLAVWCALSSYSSHKGQASTRQKKRHREDI
EDYISLFPLDDVQPSKLMRLLSSNEDDANILSSPTDRSMSSSLSASQLHTVNMRDPLNRV
LANLFLLISSILGSRTAGPHTQFVQWFMEECVDCLEQGGRGSVLQFMPFTTVSELVKVSA
MSSPKVVLAITDLSLPLGRQVAAKAIAAL
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtggtcaacctgaagcaagccattttgcaagcctggaaggagcgctggagtgac
taccaatgggcaatcaacatgaagaaattctttcctaaaggagccacctgggatattctc
aacctggcagatgcgttactagagcaggccatgattggaccatcccccaatcctctcatc
ttgtcctacctgaagtatgccattagttcccagatggtgtcctactcttctgtcctcaca
gccatcagtaagtttgatgacttttctcgggacctgtgtgtccaggcattgctggacatc
atggacatgttttgtgaccgtctgagctgtcacggcaaagcagaggaatgcatcggactg
tgccgagcccttcttagcgccctccactggctgctgcgctgcacggcagcctctgcagag
cggctgcgggaggggctggaggccggcactccagccgctggggagaagcagcttgccatg
tgccttcagcgcctggagaaaaccctcagcagcaccaagaaccgggccctgctgcacatc
gccaaactagaggaggcctcttcttggactgccatcgagcattctctcttgaaacttgga
gagatcctggccaatctcagcaacccgcagctccggagtcaggccgagcagtgtggcacc
ctcattaggagcatccccacgatgctgtctgtgcatgcggagcagatgcacaagaccggc
ttccccactgtccacgccgtgatcctgctcgagggcaccatgaacctgacaggcgagacg
cagtccctggtggagcagctgacgatggtgaagcgcatgcagcatatccccaccccactt
tttgtcctggagatctggaaagcttgcttcgtggggctcattgagtctcccgagggtacg
gaggagctcaagtggacagctttcactttcctcaagattccacaggttttggtgaagttg
aagaagtactctcatggagacaaggacttcactgaggatgtcaactgtgcttttgagttc
ctgctgaagctcacccccttgttggacaaagctgaccagcgctgcaactgtgactgtaca
aacttcctgctccaagaatgtggcaagcaggggcttctgtctgaggccagcgtcaacaac
cttatggctaagcgcaaagcggaccgagagcacgcaccccagcagaaatcgggagagaat
gccaacatccagcccaacatccagctgatcctccgggcggagcccactgtcacaaacatc
ctcaagacgatggatgcagaccactctaagtcaccggagggactgctgggagtcctgggc
cacatgctgtccgggaagagtctggacttgctgctggctgccgccgccgccactggaaag
ctgaaatccttcgcccggaaattcatcaatttgaatgaattcacaacctatggcagcgaa
gaaagcaccaaaccggcctccgtccgggccctgctgtttgacatctccttcctcatgctg
tgccatgtggcccagacctatggttcagaggtgattctgtccgagtcgcgcacaggagct
gaggtgcccttcttcgagacctggatgcagacctgcatgcctgaggagggcaagatcctg
aaccctgaccacccctgcttccgccccgactccaccaaagtggagtccctggtggccctg
ctcaacaactcctcggagatgaagctagtgcagatgaagtggcatgaggcctgtctcagc
atctcagccgccatcttggaaatcctcaatgcctgggagaatggggtcctggccttcgag
tccatccagaaaatcactgataacatcaaagggaaggtatgcagtctggcggtgtgtgct
gtggcttggcttgtggcccacgtccggatgctggggctggatgagcgtgagaagtcgctg
cagatgatccgccagctggcagggccactgtttagtgagaacaccctgcagttctacaat
gagagggtggtgatcatgaactcgatcctggagcgcatgtgtgccgacgtgctgcagcag
acagccacgcagatcaagtttccctccaccggggtggacacaatgccctactggaacctg
ctgccccccaagcggcccatcaaagaggtgctgacggacatttttgccaaggtgctggag
aagggctgggtggacagccgctccatccacatctttgacaccctgctgcacatgggcggc
gtctactggttctgcaacaacctgattaaggagctgctgaaggagacgcggaaggagcac
acgctgcgggcagtggagctgctctactccatcttctgcctggacatgcagcaagtgacc
ctggtcctgctgggccacatcctacctggcctgctcactgactcctccaagtggcacagc
ctcatggaccccccgggcactgctcttgccaagctggccgtgtggtgtgccctcagttcc
tactcctcccacaagggacaggcgtccacccgccagaagaagagacaccgcgaagacatt
gaggattatatcagcctcttccccctggacgatgtgcagccttcgaagttgatgcgactg
ctgagctctaatgaggacgatgccaacatcctttcgagccccacagaccgatccatgagc
agctccctctcagcctctcagctccacacggtcaacatgcgggaccctctgaaccgagtc
ctggccaacctgttcctgctcatctcctccatcctggggtctcgcaccgctggcccccac
acccagttcgtgcagtggttcatggaggagtgtgtggactgcctggagcagggtggccgt
ggcagcgtcctgcagttcatgcccttcaccaccgtgtcggaactggtgaaggtgtcagcc
atgtccagccccaaggtggttctggccatcacggacctcagcctgcccctgggccgccag
gtggctgctaaagccattgctgcactctga

KEGG   Homo sapiens (human): 9968Help
Entry
9968              CDS       T01001                                 

Gene name
MED12, ARC240, CAGH45, FGS1, HOPA, MED12S, OHDOX, OKS, OPA1, TNRC11, TRAP230
Definition
(RefSeq) mediator complex subunit 12
  KO
K15162  mediator of RNA polymerase II transcription subunit 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
Disease
H00889  Lujan-Fryns syndrome
H00894  FG syndrome
H01640  Uterine leiomyoma
H01795  Blepharophimosis-mental retardation syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    9968 (MED12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    9968 (MED12)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    CDK-module
     9968 (MED12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med12-LCEWAV Med12-PQL Med12
Motif
Other DBs
NCBI-GeneID: 9968
NCBI-ProteinID: NP_005111
OMIM: 300188
HGNC: 11957
Ensembl: ENSG00000184634
Vega: OTTHUMG00000021788
Pharos: Q93074(Tbio)
UniProt: Q93074
LinkDB All DBs
Position
Xq13.1
AA seq 2177 aa AA seqDB search
MAAFGILSYEHRPLKRPRLGPPDVYPQDPKQKEDELTALNVKQGFNNQPAVSGDEHGSAK
NVSFNPAKISSNFSSIIAEKLRCNTLPDTGRRKPQVNQKDNFWLVTARSQSAINTWFTDL
AGTKPLTQLAKKVPIFSKKEEVFGYLAKYTVPVMRAAWLIKMTCAYYAAISETKVKKRHV
DPFMEWTQIITKYLWEQLQKMAEYYRPGPAGSGGCGSTIGPLPHDVEVAIRQWDYTEKLA
MFMFQDGMLDRHEFLTWVLECFEKIRPGEDELLKLLLPLLLRYSGEFVQSAYLSRRLAYF
CTRRLALQLDGVSSHSSHVISAQSTSTLPTTPAPQPPTSSTPSTPFSDLLMCPQHRPLVF
GLSCILQTILLCCPSALVWHYSLTDSRIKTGSPLDHLPIAPSNLPMPEGNSAFTQQVRAK
LREIEQQIKERGQAVEVRWSFDKCQEATAGFTIGRVLHTLEVLDSHSFERSDFSNSLDSL
CNRIFGLGPSKDGHEISSDDDAVVSLLCEWAVSCKRSGRHRAMVVAKLLEKRQAEIEAER
CGESEAADEKGSIASGSLSAPSAPIFQDVLLQFLDTQAPMLTDPRSESERVEFFNLVLLF
CELIRHDVFSHNMYTCTLISRGDLAFGAPGPRPPSPFDDPADDPEHKEAEGSSSSKLEDP
GLSESMDIDPSSSVLFEDMEKPDFSLFSPTMPCEGKGSPSPEKPDVEKEVKPPPKEKIEG
TLGVLYDQPRHVQYATHFPIPQEESCSHECNQRLVVLFGVGKQRDDARHAIKKITKDILK
VLNRKGTAETDQLAPIVPLNPGDLTFLGGEDGQKRRRNRPEAFPTAEDIFAKFQHLSHYD
QHQVTAQVSRNVLEQITSFALGMSYHLPLVQHVQFIFDLMEYSLSISGLIDFAIQLLNEL
SVVEAELLLKSSDLVGSYTTSLCLCIVAVLRHYHACLILNQDQMAQVFEGLCGVVKHGMN
RSDGSSAERCILAYLYDLYTSCSHLKNKFGELFSDFCSKVKNTIYCNVEPSESNMRWAPE
FMIDTLENPAAHTFTYTGLGKSLSENPANRYSFVCNALMHVCVGHHDPDRVNDIAILCAE
LTGYCKSLSAEWLGVLKALCCSSNNGTCGFNDLLCNVDVSDLSFHDSLATFVAILIARQC
LLLEDLIRCAAIPSLLNAACSEQDSEPGARLTCRILLHLFKTPQLNPCQSDGNKPTVGIR
SSCDRHLLAASQNRIVDGAVFAVLKAVFVLGDAELKGSGFTVTGGTEELPEEEGGGGSGG
RRQGGRNISVETASLDVYAKYVLRSICQQEWVGERCLKSLCEDSNDLQDPVLSSAQAQRL
MQLICYPHRLLDNEDGENPQRQRIKRILQNLDQWTMRQSSLELQLMIKQTPNNEMNSLLE
NIAKATIEVFQQSAETGSSSGSTASNMPSSSKTKPVLSSLERSGVWLVAPLIAKLPTSVQ
GHVLKAAGEELEKGQHLGSSSRKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLL
TSLYSQVHQIVNNWRDDQYLDDCKPKQLMHEALKLRLNLVGGMFDTVQRSTQQTTEWAML
LLEIIISGTVDMQSNNELFTTVLDMLSVLINGTLAADMSSISQGSMEENKRAYMNLAKKL
QKELGERQSDSLEKVRQLLPLPKQTRDVITCEPQGSLIDTKGNKIAGFDSIFKKEGLQVS
TKQKISPWDLFEGLKPSAPLSWGWFGTVRVDRRVARGEEQQRLLLYHTHLRPRPRAYYLE
PLPLPPEDEEPPAPTLLEPEKKAPEPPKTDKPGAAPPSTEERKKKSTKGKKRSQPATKTE
DYGMGPGRSGPYGVTVPPDLLHHPNPGSITHLNYRQGSIGLYTQNQPLPAGGPRVDPYRP
VRLPMQKLPTRPTYPGVLPTTMTGVMGLEPSSYKTSVYRQQQPAVPQGQRLRQQLQQSQG
MLGQSSVHQMTPSSSYGLQTSQGYTPYVSHVGLQQHTGPAGTMVPPSYSSQPYQSTHPST
NPTLVDPTRHLQQRPSGYVHQQAPTYGHGLTSTQRFSHQTLQQTPMISTMTPMSAQGVQA
GVRSTAILPEQQQQQQQQQQQQQQQQQQQQQQQQQQYHIRQQQQQQILRQQQQQQQQQQQ
QQQQQQQQQQQQQQQHQQQQQQQAAPPQPQPQSQPQFQRQGLQQTQQQQQTAALVRQLQQ
QLSNTQPQPSTNIFGRY
NT seq 6534 nt NT seq  +upstreamnt  +downstreamnt
atggcggccttcgggatcttgagctacgaacaccggcccctgaagcggccgcggctgggg
cctcccgatgtttaccctcaggaccccaaacagaaggaggatgaactgacggccttgaat
gtaaaacaaggtttcaataaccagcctgctgtctctggggatgagcatggcagtgccaag
aacgtcagcttcaatcctgccaagatcagttccaacttcagcagcattattgcagagaaa
ttacgttgtaatacccttcctgacactggtcgcaggaagccccaagtgaaccagaaggat
aacttctggctggtgactgcacgatcccagagtgccattaacacttggttcactgacttg
gctggcaccaagccactcacgcaactagccaaaaaggtccccattttcagtaagaaggaa
gaggtgtttgggtacttagccaaatacacagtgcctgtgatgcgggctgcctggctcatt
aagatgacctgtgcctactatgcagcaatctctgagaccaaggttaagaagagacatgtt
gaccctttcatggaatggactcagatcatcaccaagtacttatgggagcagttacagaag
atggctgaatactaccggccagggcctgcaggaagtgggggctgtggttccacgataggg
cccttgccccatgatgtagaggtggcaatccggcagtgggattacaccgagaagctggcc
atgttcatgtttcaggatggaatgctggacagacatgagttcctgacctgggtgcttgag
tgttttgagaagatccgccctggagaggatgaattgcttaaactgctgctgcctctgctt
ctccgatactctggggaatttgttcagtctgcatacctgtcccgccggcttgcctacttc
tgtacacggagactggccctgcagctggatggtgtgagcagtcactcatctcatgttata
tctgctcagtcaacaagcacgctacccaccacccctgctcctcagcccccaactagcagc
acaccctcgactccctttagtgacctgcttatgtgccctcagcaccggcccctggttttt
ggcctcagctgtatcctacagaccatcctcctgtgctgtcctagtgccttggtttggcac
tactcactgactgatagcagaattaagaccggctcaccacttgaccacttgcctattgcc
ccgtccaacctgcccatgccagagggtaacagtgccttcactcagcaggtccgtgcaaag
ttgcgggagatcgagcagcagatcaaggagcggggacaggcagttgaagttcgctggtct
ttcgataaatgccaggaagctactgcaggcttcaccattggacgggtacttcatactttg
gaagtgctggacagccatagttttgaacgctctgacttcagcaactctcttgactccctt
tgtaaccgaatctttggattgggacctagcaaggatgggcatgagatctcctcagatgat
gatgctgtggtgtcattgctatgtgaatgggctgtcagctgcaagcgttctggtcggcat
cgtgctatggtggtagccaagctcctggagaagagacaggcggagattgaggctgagcgt
tgtggagaatcagaagccgcagatgagaagggttccatcgcctctggctccctttctgct
cccagtgctcccattttccaggatgtcctcctgcagtttctggatacacaggctcccatg
ctgacggaccctcgaagtgagagtgagcgggtggaattctttaacttagtactgctgttc
tgtgaactgattcgacatgatgttttctcccacaacatgtatacttgcactctcatctcc
cgaggggaccttgcctttggagcccctggtccccggcctccctctccctttgatgatcct
gccgatgacccagagcacaaggaggctgaaggcagcagcagcagcaagctggaagatcca
gggctctcagaatctatggacattgaccctagttccagtgttctctttgaggacatggag
aagcctgatttctcattgttctcccctactatgccctgtgaggggaagggcagtccatcc
cctgagaagccagatgtcgagaaggaggtgaagcccccacccaaggagaagattgaaggg
acccttggggttctttacgaccagccacgacacgtgcagtacgccacccattttcccatc
ccccaggaggagtcatgcagccatgagtgcaaccagcggttggtcgtactgtttggggtg
ggaaagcagcgagatgatgcccgccatgccatcaagaaaatcaccaaggatatcttgaag
gttctgaaccgcaaagggacagcagaaactgaccagcttgctcctattgtgcctctgaat
cctggagacctgacattcttaggtggggaggatgggcagaagcggcgacgcaaccggcct
gaagccttccccactgctgaagatatctttgctaagttccagcacctttcacattatgac
caacaccaggtcacggctcaggtctcccggaatgttctggagcagatcacgagctttgcc
cttggcatgtcataccacttgcctctggtgcagcatgtgcagttcatcttcgacctcatg
gaatattcactcagcatcagtggcctcatcgactttgccattcagctgctgaatgaactg
agtgtagttgaggctgagctgcttctcaaatcctcggatctggtgggcagctacactact
agcctgtgcctgtgcatcgtggctgtcctgcggcactatcatgcctgcctcatcctcaac
caggaccagatggcacaggtctttgaggggctgtgtggcgtcgtgaagcatgggatgaac
cggtccgatggctcctctgcagagcgctgtatccttgcttatctctatgatctgtacacc
tcctgtagccatttaaagaacaaatttggggagctcttcagcgacttttgctcaaaggtg
aagaacaccatctactgcaacgtggagccatcggaatcaaatatgcgctgggcacctgag
ttcatgatcgacactctagagaaccctgcagctcacaccttcacctacacggggctaggc
aagagtcttagtgagaaccctgctaaccgctacagctttgtctgcaatgcccttatgcac
gtctgtgtggggcaccatgatcccgatagggtgaatgacatcgcaatcctgtgtgcagag
ctgaccggctattgcaagtcactgagtgcagaatggctaggagtgcttaaggccttgtgc
tgctcctctaacaatggcacttgtggtttcaacgatctcctctgcaatgttgatgtcagt
gacctatcttttcatgactcgctggctacttttgttgccatcctcatcgctcggcagtgt
ttgctcctggaagatctgattcgctgtgctgccatcccttcactccttaatgctgcttgt
agtgaacaggactctgagccaggggcccggcttacctgccgcatcctccttcaccttttc
aagacaccgcagctcaatccttgccagtctgatggaaacaagcctacagtaggaatccgc
tcctcctgcgaccgccacctgctggctgcctcccagaaccgcatcgtggatggagccgtg
tttgctgttctcaaggctgtgtttgtacttggggatgcggaactgaaaggttcaggcttc
actgtgacaggaggaacagaagaacttccagaggaggagggaggaggtggcagtggtggt
cggaggcagggtggccgcaacatctctgtggagacagccagtctggatgtctatgccaag
tacgtgctgcgcagcatctgccaacaggaatgggtaggagaacgttgccttaagtctctg
tgtgaggacagcaatgacctgcaagacccagtgttgagtagtgcccaggcgcagcgcctc
atgcagctcatttgctatccacatcgactgctggacaatgaggatggggaaaacccccag
cggcagcgcataaagcgcattctccagaacttggaccagtggaccatgcgccagtcttcc
ttggagctgcagctcatgatcaagcagacccctaacaatgagatgaactccctcttggag
aacatcgccaaggccacaatcgaggttttccaacagtcagcagagacagggtcatcttct
ggaagtactgcaagcaacatgcccagcagcagcaagaccaagcctgtgctcagctctcta
gagcgctctggtgtatggctggtggcccccctcattgctaaactgcccacctcagtccag
ggacatgtgttaaaggctgctggggaagaattggagaagggtcagcacctgggttcctct
tcacgcaaagaacgtgatcgacaaaagcagaagagcatgtccctattgagccagcagccc
ttcttatcgctggtgctaacatgtctgaaagggcaggatgaacaacgcgagggactcctt
acctccctctacagccaggtgcaccagattgtgaataattggcgagatgaccagtactta
gatgattgcaaaccaaagcagcttatgcatgaggcactcaaactgcggctcaacctggtg
gggggcatgtttgacacggtgcagcgcagcacccagcagaccacggagtgggccatgctc
ctcctggagatcatcatcagcggcactgtcgacatgcagtccaacaatgagctcttcact
actgtgttggacatgctgagcgtgctcatcaatgggacattggctgcagacatgtctagc
atctcgcaaggtagcatggaggaaaacaagcgtgcatacatgaacctggcgaagaagttg
cagaaggagttgggggagcgccagtcagacagtctggaaaaggttcgccagctgctgcca
ctgcccaagcagacccgagatgtcatcacgtgtgagccacagggctcccttatcgatacc
aagggcaacaagattgctggcttcgattccatcttcaagaaggagggtctacaggtttcc
accaaacagaagatctcgccctgggatctttttgaggggttgaagccgtcagcaccactc
tcttggggctggtttggaacagtccgagtggaccggcgagtggctcgaggagaggagcag
cagcggttgctgctctaccacacacacctgaggccccggccccgcgcctattacctggag
ccactgccactgcccccagaagatgaggagccgcctgctcctaccctgctagagcctgag
aaaaaggctccagagccccccaaaactgacaaaccgggggctgctccacccagtactgag
gaacgcaagaagaagtccaccaagggcaagaaacgcagccagccagctaccaagacagag
gactatggaatgggcccgggtcggagcggcccttatggtgtgacagtgcctccggacctc
ctgcaccacccaaaccctggttctataacacaccttaactacaggcaaggctccataggc
ctgtacacccagaaccagccactacctgcaggtggccctcgtgtggacccataccgtcct
gtgcgcttaccaatgcagaagctgcccacccgaccaacttaccctggagtgctgcccaca
accatgactggcgtcatgggtttagaaccctcctcttataagacctctgtgtaccggcag
cagcaacctgcggtgccccaaggacagcgccttcgccaacagctccagcagagtcagggc
atgttgggacagtcatctgtccatcagatgactcccagctcttcctacggtttgcagact
tcccagggctatactccttatgtttctcatgtgggattgcagcaacacacaggccctgca
ggtaccatggtgccccccagctactccagccagccttaccagagcacccacccttctacc
aatcctactcttgtagatcctacccgccacctgcaacagcggcccagtggctatgtgcac
cagcaggcccccacctatggacatggactgacctccactcaaaggttttcacaccagaca
ctgcagcagacacccatgataagtaccatgactccaatgagtgcccagggcgtccaggca
ggcgtccgttcaacagccatcctacctgagcagcagcagcagcagcaacagcagcaacag
caacagcagcagcagcagcaacagcaacagcagcagcagcagcagcagtaccacatccgg
cagcagcagcagcagcagatcctgcggcagcagcagcaacagcaacagcagcagcagcag
cagcagcaacagcaacagcagcagcagcaacagcaacaacagcaacaccagcagcaacag
cagcaacaggcggctcctccccaaccccagccccagtcccagccccagttccagcgccag
gggcttcagcagacccagcagcagcaacagacagcagctttggtccggcaacttcaacaa
cagctctctaatacccagccacagcccagtaccaacatatttggacgctactga

KEGG   Homo sapiens (human): 9969Help
Entry
9969              CDS       T01001                                 

Gene name
MED13, ARC250, DRIP250, HSPC221, THRAP1, TRAP240
Definition
(RefSeq) mediator complex subunit 13
  KO
K15164  mediator of RNA polymerase II transcription subunit 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    9969 (MED13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    9969 (MED13)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    CDK-module
     9969 (MED13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med13_C MID_MedPIWI Med13_N
Motif
Other DBs
NCBI-GeneID: 9969
NCBI-ProteinID: NP_005112
OMIM: 603808
HGNC: 22474
Ensembl: ENSG00000108510
Vega: OTTHUMG00000179251
Pharos: Q9UHV7(Tbio)
UniProt: Q9UHV7 A0A024QZ75
LinkDB All DBs
Position
17q23.2
AA seq 2174 aa AA seqDB search
MSASFVPNGASLEDCHCNLFCLADLTGIKWKKYVWQGPTSAPILFPVTEEDPILSSFSRC
LKADVLGVWRRDQRPGRRELWIFWWGEDPSFADLIHHDLSEEEDGVWENGLSYECRTLLF
KAVHNLLERCLMNRNFVRIGKWFVKPYEKDEKPINKSEHLSCSFTFFLHGDSNVCTSVEI
NQHQPVYLLSEEHITLAQQSNSPFQVILCPFGLNGTLTGQAFKMSDSATKKLIGEWKQFY
PISCCLKEMSEEKQEDMDWEDDSLAAVEVLVAGVRMIYPACFVLVPQSDIPTPSPVGSTH
CSSSCLGVHQVPASTRDPAMSSVTLTPPTSPEEVQTVDPQSVQKWVKFSSVSDGFNSDST
SHHGGKIPRKLANHVVDRVWQECNMNRAQNKRKYSASSGGLCEEATAAKVASWDFVEATQ
RTNCSCLRHKNLKSRNAGQQGQAPSLGQQQQILPKHKTNEKQEKSEKPQKRPLTPFHHRV
SVSDDVGMDADSASQRLVISAPDSQVRFSNIRTNDVAKTPQMHGTEMANSPQPPPLSPHP
CDVVDEGVTKTPSTPQSQHFYQMPTPDPLVPSKPMEDRIDSLSQSFPPQYQEAVEPTVYV
GTAVNLEEDEANIAWKYYKFPKKKDVEFLPPQLPSDKFKDDPVGPFGQESVTSVTELMVQ
CKKPLKVSDELVQQYQIKNQCLSAIASDAEQEPKIDPYAFVEGDEEFLFPDKKDRQNSER
EAGKKHKVEDGTSSVTVLSHEEDAMSLFSPSIKQDAPRPTSHARPPSTSLIYDSDLAVSY
TDLDNLFNSDEDELTPGSKKSANGSDDKASCKESKTGNLDPLSCISTADLHKMYPTPPSL
EQHIMGFSPMNMNNKEYGSMDTTPGGTVLEGNSSSIGAQFKIEVDEGFCSPKPSEIKDFS
YVYKPENCQILVGCSMFAPLKTLPSQYLPPIKLPEECIYRQSWTVGKLELLSSGPSMPFI
KEGDGSNMDQEYGTAYTPQTHTSFGMPPSSAPPSNSGAGILPSPSTPRFPTPRTPRTPRT
PRGAGGPASAQGSVKYENSDLYSPASTPSTCRPLNSVEPATVPSIPEAHSLYVNLILSES
VMNLFKDCNFDSCCICVCNMNIKGADVGVYIPDPTQEAQYRCTCGFSAVMNRKFGNNSGL
FLEDELDIIGRNTDCGKEAEKRFEALRATSAEHVNGGLKESEKLSDDLILLLQDQCTNLF
SPFGAADQDPFPKSGVISNWVRVEERDCCNDCYLALEHGRQFMDNMSGGKVDEALVKSSC
LHPWSKRNDVSMQCSQDILRMLLSLQPVLQDAIQKKRTVRPWGVQGPLTWQQFHKMAGRG
SYGTDESPEPLPIPTFLLGYDYDYLVLSPFALPYWERLMLEPYGSQRDIAYVVLCPENEA
LLNGAKSFFRDLTAIYESCRLGQHRPVSRLLTDGIMRVGSTASKKLSEKLVAEWFSQAAD
GNNEAFSKLKLYAQVCRYDLGPYLASLPLDSSLLSQPNLVAPTSQSLITPPQMTNTGNAN
TPSATLASAASSTMTVTSGVAISTSVATANSTLTTASTSSSSSSNLNSGVSSNKLPSFPP
FGSMNSNAAGSMSTQANTVQSGQLGGQQTSALQTAGISGESSSLPTQPHPDVSESTMDRD
KVGIPTDGDSHAVTYPPAIVVYIIDPFTYENTDESTNSSSVWTLGLLRCFLEMVQTLPPH
IKSTVSVQIIPCQYLLQPVKHEDREIYPQHLKSLAFSAFTQCRRPLPTSTNVKTLTGFGP
GLAMETALRSPDRPECIRLYAPPFILAPVKDKQTELGETFGEAGQKYNVLFVGYCLSHDQ
RWILASCTDLYGELLETCIINIDVPNRARRKKSSARKFGLQKLWEWCLGLVQMSSLPWRV
VIGRLGRIGHGELKDWSCLLSRRNLQSLSKRLKDMCRMCGISAADSPSILSACLVAMEPQ
GSFVIMPDSVSTGSVFGRSTTLNMQTSQLNTPQDTSCTHILVFPTSASVQVASATYTTEN
LDLAFNPNNDGADGMGIFDLLDTGDDLDPDIINILPASPTGSPVHSPGSHYPHGGDAGKG
QSTDRLLSTEPHEEVPNILQQPLALGYFVSTAKAGPLPDWFWSACPQAQYQCPLFLKASL
HLHVPSVQSDELLHSKHSHPLDSNQTSDVLRFVLEQYNALSWLTCDPATQDRRSCLPIHF
VVLNQLYNFIMNML
NT seq 6525 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcctccttcgtgccgaacggggccagcctggaagattgtcactgtaacctcttc
tgcctggctgacttgacaggaattaagtggaaaaaatatgtatggcaaggcccaacttct
gcccctattctgtttcctgtgacagaagaagaccccattttgagcagttttagtcgctgc
cttaaggcagatgtacttggtgtttggcggcgagatcaaagacctggaagaagagaattg
tggatattttggtggggtgaagaccccagttttgctgaccttattcaccatgacttatca
gaagaagaagatggagtgtgggagaatggactttcctatgaatgccgtactctgcttttc
aaagcagttcacaatctattggaacggtgtttaatgaacaggaattttgtacgtattggc
aagtggtttgtaaagccttatgaaaaagatgaaaaacctataaataaaagtgaacacttg
tcctgctccttcacctttttcttgcatggagacagcaatgtttgtaccagtgtggaaatt
aaccaacatcaacctgtataccttctcagtgaagagcatatcacccttgctcaacagtct
aatagcccatttcaagttatcttatgcccatttggactaaatggcactctcacaggacag
gcattcaagatgtctgattcagctacaaaaaaattaattggtgaatggaaacagttctat
cctatctcatgttgcttgaaggagatgtctgaagaaaaacaggaagatatggattgggaa
gatgattctttagctgcagtagaagttcttgttgctggtgtccgaatgatctacccagca
tgctttgttctagtccctcagtcagacattcctactcctagccctgtgggatccactcac
tgttcatcttcttgcttgggtgtccaccaagtgcctgcttccacaagagatcctgctatg
tcttcggttacgcttacaccacctacgtctcctgaggaagtccaaacagttgatcctcag
tctgtccagaagtgggtcaaattttcttcagtatctgatggcttcaactccgatagtact
agccaccatggtgggaaaatacccagaaaattagcaaatcatgtggtggatagagtttgg
caagaatgcaatatgaacagagcacagaacaagaggaagtattctgcttcatcaggtggt
ctatgcgaagaagcgacagctgctaaagtggcatcctgggattttgttgaagccacacaa
agaacaaattgcagttgtttgaggcacaaaaatctcaagtcaagaaatgctggacaacaa
ggacaggcaccatctttaggtcagcaacaacaaatacttcctaagcacaagaccaatgag
aagcaagaaaagagtgaaaagccacagaaacgccccttgactccttttcaccatcgtgtg
tctgttagtgatgatgttggcatggacgcagattcagccagccaaagacttgtgatctct
gctccagacagtcaagtgagattttcaaatatccgaactaatgatgtagcaaagactcct
cagatgcatggcaccgaaatggcaaattcacctcaaccacccccacttagtcctcaccct
tgtgatgtggttgatgaaggagtgactaaaacaccttcaactcctcagagtcaacatttt
tatcaaatgccaacaccagatcccttggttccttctaaaccaatggaagataggatagac
agtttgtcccagtctttcccacctcaatatcaggaagctgtagaacctacagtatatgtt
ggtacagcagtaaacttggaagaagatgaagccaatatagcctggaagtattacaagttc
ccaaagaaaaaagatgtagagtttttaccacctcaacttccaagtgataaattcaaggat
gatccagttggaccttttggacaggaaagtgtaacatcagttacagagttaatggtgcaa
tgtaagaaacctttaaaagtttctgatgaattagtgcagcaatatcaaattaaaaaccag
tgtctttcagcaatagcatctgatgcagaacaagaacctaaaattgatccatatgcattt
gttgaaggagatgaggaattcctttttcctgataaaaaagatagacaaaatagtgagaga
gaagctggaaaaaaacacaaggtagaagatgggacatctagtgtaacagtgttatcacat
gaagaagatgctatgtcattatttagtccctctatcaagcaagatgctccacgccctact
agtcatgcccgtcctccatcaacaagtttgatttatgactcagacctggctgtctcttat
actgaccttgataatctcttcaattctgatgaagatgaactaacacctggatctaaaaaa
tcagcaaatggatcagatgataaagccagctgcaaggaatcaaagacaggaaatctggac
ccgttatcttgcataagcactgcagatcttcataaaatgtatcctacaccaccatcattg
gaacaacatattatgggattttccccaatgaatatgaataataaagaatatggtagtatg
gatacaacacctggaggaactgttctagaaggaaatagttctagtataggagcgcagttc
aaaattgaggttgatgagggattctgtagccccaaaccttctgaaattaaagatttttct
tatgtctataagcctgaaaattgtcaaattctagtgggatgttccatgtttgcacctcta
aaaactctaccaagccaatatctgccccctatcaaattgccagaagagtgtatttaccgt
cagagttggactgttggaaaattggaattgctttcttcagggccttcaatgccattcatc
aaagagggtgatggaagtaatatggatcaagaatatggcactgcttatacacctcaaact
catacttcttttgggatgcctcctagcagtgcacctcctagtaacagcggagcaggaatt
cttccttctccatccacccctcggtttccaactccaaggactccaaggactcctcggact
cctcgtggagctggtggacctgctagtgctcaaggttcagtcaaatatgaaaattcagac
ttgtattcaccagcttctaccccatctacatgcagaccccttaattctgttgaacctgca
actgtcccttccatccctgaagcacacagtctttatgtaaacctcatcctttcagaatca
gttatgaatttgtttaaagactgtaactttgatagttgttgcatctgtgtttgcaacatg
aacatcaagggtgccgatgttggagtttacattccagatccaacgcaggaagcacaatat
aggtgtacctgtggcttcagtgctgtcatgaacagaaaatttggaaacaattcaggatta
tttcttgaagatgaactagatatcataggacgcaatacagactgtggcaaagaagcagaa
aaacgttttgaagctctcagggctacctctgctgaacatgttaatggaggactaaaggaa
tctgaaaaattatctgatgatttgatattattgctacaagatcagtgcactaatttattt
tcaccctttggagcagcagaccaagatccttttcctaaaagtggtgtaattagcaattgg
gtacgtgttgaagagcgtgactgttgcaatgactgctaccttgcattagaacatgggcgt
cagttcatggataacatgtcaggaggaaaagttgatgaagcacttgtgaaaagttcatgc
ttacacccctggtccaaaagaaacgatgtgagtatgcagtgctcacaggatatacttcga
atgctcctctctcttcagccagttcttcaggatgccattcagaaaaaaagaacagtaaga
ccttggggtgttcagggtcctctcacttggcaacaatttcataaaatggctggccgaggc
tcttatggaactgatgaatccccagaaccactgccaatccccacatttttgttgggttat
gattatgattatctggtgctttctccatttgctcttccttattgggagagacttatgctg
gaaccctatggatctcaaagagatatagcctatgttgtactgtgtccagaaaatgaagcc
ttgttaaatggagcaaaaagcttttttagagatcttactgcaatatatgagtcctgtcga
ttaggtcaacatagacctgtttctcgactgttaacagatgggatcatgagagttggatct
actgcatcaaagaaactatcagaaaagttggtagcagaatggttttctcaggcagctgac
ggtaacaatgaagcattttctaaactcaagctttatgcacaagtctgcagatatgaccta
ggtccttatcttgcttccctgccattggacagctctctactttcccagccaaatttagtt
gcccctacaagtcagtctttgattactccacctcagatgacaaatactggaaatgctaat
actccatctgccaccttagcatctgcagcgagcagcactatgacagtgacttcaggtgtt
gccatatctacttcagttgccacagctaattcaactttgaccacagcttcaacttcatct
tcatcatcctccaacttgaatagtggagtatcatcaaataaactaccttcgtttccaccc
tttggcagtatgaacagtaatgctgcaggatccatgtctacacaagcaaatacagttcag
agtggtcagctaggagggcaacagacatcagctctacagacagctgggatttctggagaa
tcatcttcacttcccactcagccgcatcctgatgtgtctgaaagcacgatggatcgggat
aaagtgggaatccccacagatggtgattcacatgcagtcacgtatccacctgcaattgtt
gtttatataattgatccttttacatacgaaaatacagacgagagcactaactcttctagt
gtgtggacattggggctacttcgatgctttctagaaatggtccagactcttcctcctcat
atcaagagtactgtttctgtacagattattccttgtcagtacctgttgcaacctgtgaag
catgaagatagagaaatctatccccagcatttaaaatccctggctttttcggcctttacc
cagtgtcggaggccacttccaacatcaaccaatgtgaaaacattgactggctttggtcca
ggtttagccatggaaactgcccttagaagtcctgatagaccagagtgtattcgactttat
gcacctccttttattctggctccagtgaaggacaaacagacagagctaggagaaacattt
ggagaagctggacagaaatataatgttctttttgtgggatactgtttatcacatgatcaa
aggtggattcttgcatcttgcacagatctatatggagaacttttagaaacttgtatcatt
aacatcgatgttccaaatagggctcgtcggaaaaaaagttctgctagaaaatttggtcta
cagaaactttgggagtggtgcttaggacttgtacaaatgagttcattgccatggagagtt
gtaattggtcgtctaggaaggattggtcatggagaattgaaagattggagctgtttgctg
agtcgtcgaaacttgcagtctctaagtaaaaggctcaaagacatgtgtagaatgtgtggt
atatctgctgcagactcccctagcattctcagtgcttgcttggtggcaatggagccgcaa
ggctcttttgttattatgccagattctgtgtcaactggttctgtatttggaagaagcacg
actctaaatatgcagacatctcagctaaataccccacaggatacatcatgtactcatata
cttgtgtttcctacttctgcttctgtgcaagtagcttcagctacttataccactgaaaat
ttggatttagctttcaatcccaacaatgatggagcagatggaatgggtatctttgatttg
ttagacacaggagatgatcttgaccctgatatcattaatatccttcctgcttctccaact
ggttctcctgtacattctccaggatctcattacccccatggaggtgatgcgggcaagggt
cagagtactgatcggctactatcaacagaacctcatgaggaagtacctaatattcttcag
caaccattggcccttggttactttgtatcaactgccaaagcaggtccattacctgactgg
ttctggtcagcatgtcctcaagcacaatatcagtgtcccctttttcttaaggcctctttg
cacctccacgtgccttcagtgcaatctgacgagctgcttcacagtaaacactcccaccca
cttgactcaaatcagacttcagatgtcctcaggtttgttttggaacagtacaatgcactc
tcctggctaacctgtgaccctgcaacccaggacagacgctcatgtctcccaattcatttt
gtggtgctgaatcagttatataactttattatgaatatgctgtga

DBGET integrated database retrieval system