KEGG   Homo sapiens (human): 100287171Help
Entry
100287171         CDS       T01001                                 

Gene name
WASHC1, FAM39E, WASH, WASH1
Definition
(RefSeq) WASH complex subunit 1
  KO
K18461  WAS protein family homolog 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100287171 (WASHC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    100287171 (WASHC1)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Others
   WASH complex
    100287171 (WASHC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WASH_WAHD
Motif
Other DBs
NCBI-GeneID: 100287171
NCBI-ProteinID: NP_878908
OMIM: 613632
HGNC: 24361
Ensembl: ENSG00000181404
Vega: OTTHUMG00000019420
Pharos: A8K0Z3(Tbio)
UniProt: A8K0Z3
LinkDB All DBs
Position
9p24.3
AA seq 465 aa AA seqDB search
MTPVRMQHSLAGQTYAVPFIQPDLRREEAVQQMADALQYLQKVSGDIFSRISQQVEQSRS
QVQAIGEKVSLAQAKIEKIKGSKKAIKVFSSAKYPAPGRLQEYGSIFTGAQDPGLQRRPR
HRIQSKHRPLDERALQEKLKDFPVCVSTKPEPEDDAEEGLGGLPSNISSVSSLLLFNTTE
NLYKKYVFLDPLAGAVTKTHVMLGAETEEKLFDAPLSISKREQLEQQVPENYFYVPDLGQ
VPEIHVPSYLPDLPGIANDLMYSADLGPGIAPSAPGTIPELPTFHTEVAEPLKVDLQDGV
LTPPPPPPPPPPAPEVLASAPPLPPSTAAPVGQGARQDDSSSSASPSVQGAPREVVDPSG
GWATLLESIRQAGGIGKAKLRSMKERKLEKQQQKEQEQVRATSQGGHLMSDLFNKLVMRR
KGISGKGPGAGEGPGGAFVRVSDSIPPLPPPQQPQAEEDEDDWES
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgactcctgtgaggatgcagcactccctggcaggtcagacctatgccgtgcccttcatc
cagccagacctgcggcgagaggaggccgtccagcagatggcggatgccctgcagtacctg
cagaaggtctctggagacatcttcagcaggatctcccagcaggtagagcagagccggagc
caggtgcaggccattggagagaaggtctccttggcccaggccaagattgagaagatcaag
ggcagcaagaaggccatcaaggtgttctccagtgccaagtaccctgctccagggcgcctg
caggaatatggctccatcttcacgggcgcccaggaccctggcctgcagagacgcccccgc
cacaggatccagagcaagcaccgccccctggacgagcgggccctgcaggagaagctgaag
gactttcctgtgtgcgtgagcaccaagccggagcccgaggacgatgcagaagagggactt
gggggtcttcccagcaacatcagctctgtcagctccttgctgctcttcaacaccaccgag
aacctgtacaagaagtatgtcttcctggaccccctggctggtgctgtaacaaagacccat
gtgatgctgggggcagagacagaggagaagctgtttgatgcccccttgtccatcagcaag
agagagcagctggaacagcaggtcccagagaactacttctatgtgccagacctgggccag
gtgcctgagatccatgttccatcctacctgcctgacctgcccggcattgccaacgacctc
atgtacagtgccgacctgggccccggcattgccccctctgcccctggcaccattccagaa
ctgcccaccttccacactgaggtagccgagcctctcaaggtagacctacaagatggggta
ctaacaccacccccaccgcccccaccaccacccccagctcctgaggtgctggccagtgca
cccccactcccaccctcaaccgcggcccctgtaggccaaggcgccaggcaggacgacagc
agcagcagcgcatctccttcagtccagggagctcccagggaagtggtcgacccctccggt
ggctgggccactctgctagagtccatccgccaagctgggggcatcggcaaggccaagctg
cgcagcatgaaggagcgaaagctggagaagcagcagcagaaggagcaggagcaagtgaga
gccacgagccaaggtgggcacttgatgtcggatctcttcaacaagctggtcatgaggcgc
aagggcatctctgggaaaggacctggggctggtgaggggcccggaggagcctttgtccgc
gtgtcagactccatccctcctttgccgccaccgcagcagccacaggcagaggaggacgag
gacgactgggaatcgtag

DBGET integrated database retrieval system