KEGG   Homo sapiens (human): 100506658Help
Entry
100506658         CDS       T01001                                 

Gene name
OCLN, BLCPMG, PPP1R115, PTORCH1
Definition
(RefSeq) occludin
  KO
K06088  occludin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Disease
H00840  Band-like calcification with simplified gyration and polymicrogyria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100506658 (OCLN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100506658 (OCLN)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100506658 (OCLN)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    100506658 (OCLN)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100506658 (OCLN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    100506658 (OCLN)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    100506658 (OCLN)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100506658 (OCLN)
Transporters [BR:hsa02000]
 Other transporters
  Others
   100506658 (OCLN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Occludin_ELL MARVEL Laminin_II DUF4164 TMF_TATA_bd FapA KxDL APG6_N DUF4200 PRKG1_interact UPF0184 Swi5
Motif
Other DBs
NCBI-GeneID: 100506658
NCBI-ProteinID: NP_001192183
OMIM: 602876
HGNC: 8104
Ensembl: ENSG00000197822
Vega: OTTHUMG00000099356
Pharos: Q16625(Tbio)
UniProt: Q16625 A8K3T2
LinkDB All DBs
Structure
PDB: 

Position
5q13.2
AA seq 522 aa AA seqDB search
MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTS
PPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTSLLGGSVGYPYGGSGFGSYGSGYGY
GYGYGYGYGGYTDPRAAKGFMLAMAAFCFIAALVIFVTSVIRSEMSRTRRYYLSVIIVSA
ILGIMVFIATIVYIMGVNPTAQSSGSLYGSQIYALCNQFYTPAATGLYVDQYLYHYCVVD
PQEAIAIVLGFMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKN
VSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPV
DDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREY
PPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADE
YNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccaggcctcttgaaagtccacctccttacaggcctgatgaattcaaaccgaat
cattatgcaccaagcaatgacatatatggtggagagatgcatgttcgaccaatgctctct
cagccagcctactctttttacccagaagatgaaattcttcacttctacaaatggacctct
cctccaggagtgattcggatcctgtctatgctcattattgtgatgtgcattgccatcttt
gcctgtgtggcctccacgcttgcctgggacagaggctatggaacttcccttttaggaggt
agtgtaggctacccttatggaggaagtggctttggtagctacggaagtggctatggctat
ggctatggttatggctatggctacggaggctatacagacccaagagcagcaaagggcttc
atgttggccatggctgccttttgtttcattgccgcgttggtgatctttgttaccagtgtt
ataagatctgaaatgtccagaacaagaagatactacttaagtgtgataatagtgagtgct
atcctgggcatcatggtgtttattgccacaattgtctatataatgggagtgaacccaact
gctcagtcttctggatctctatatggttcacaaatatatgccctctgcaaccaattttat
acacctgcagctactggactctacgtggatcagtatttgtatcactactgtgttgtggat
ccccaggaggccattgccattgtactggggttcatgattattgtggcttttgctttaata
attttctttgctgtgaaaactcgaagaaagatggacaggtatgacaagtccaatattttg
tgggacaaggaacacatttatgatgagcagccccccaatgtcgaggagtgggttaaaaat
gtgtctgcaggcacacaggacgtgccttcacccccatctgactatgtggaaagagttgac
agtcccatggcatactcttccaatggcaaagtgaatgacaagcggttttatccagagtct
tcctataaatccacgccggttcctgaagtggttcaggagcttccattaacttcgcctgtg
gatgacttcaggcagcctcgttacagcagcggtggtaactttgagacaccttcaaaaaga
gcacctgcaaagggaagagcaggaaggtcaaagagaacagagcaagatcactatgagaca
gactacacaactggcggcgagtcctgtgatgagctggaggaggactggatcagggaatat
ccacctatcacttcagatcaacaaagacaactgtacaagaggaattttgacactggccta
caggaatacaagagcttacaatcagaacttgatgagatcaataaagaactctcccgtttg
gataaagaattggatgactatagagaagaaagtgaagagtacatggctgctgctgatgaa
tacaatagactgaagcaagtgaagggatctgcagattacaaaagtaagaagaatcattgc
aagcagttaaagagcaaattgtcacacatcaagaagatggttggagactatgatagacag
aaaacatag

DBGET integrated database retrieval system