KEGG   Homo sapiens (human): 100507290Help
Entry
100507290         CDS       T01001                                 

Gene name
ZNF865
Definition
(RefSeq) zinc finger protein 865
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_jaz zf-met zf-C2H2_6 zf-C2H2_8 BolA Zn-ribbon_8 zf-Di19 zf-C2HC_2
Motif
Other DBs
NCBI-GeneID: 100507290
NCBI-ProteinID: NP_001182534
HGNC: 38705
Ensembl: ENSG00000261221
Vega: OTTHUMG00000177108
Pharos: P0CJ78(Tdark)
UniProt: P0CJ78
LinkDB All DBs
Position
19q13.42
AA seq 1059 aa AA seqDB search
MEANPAGSGAGGGGSSGIGGEDGVHFQSYPFDFLEFLNHQRFEPMELYGEHAKAVAALPC
APGPPPQPPPQPPPPQYDYPPQSTFKPKAEVPSSSSSSSSSSSSSSSSSSSSSSSSSQAK
KPDPPLPPAFGAPPPPLFDAAFPTPQWGIVDLSGHQHLFGNLKRGGPASGPGVTPGLGAP
AGAPGPLPAPSQTPPGPPAAAACDPTKDDKGYFRRLKYLMERRFPCGVCQKSFKQSSHLV
QHMLVHSGERPYECGVCGRTYNHVSSLIRHRRCHKDVPPAAGGPPQPGPHLPPLGLPAPA
ASAATAAAPSTVSSGPPATPVAPAPSADGSAAPAGVGVPPPATGGGDGPFACPLCWKVFK
KPSHLHQHQIIHTGEKPFSCSVCSKSFNRRESLKRHVKTHSADLLRLPCGICGKAFRDAS
YLLKHQAAHAGAGAGGPRPVYPCDLCGKSYSAPQSLLRHKAAHAPPAAAAEAPKDGAASA
PQPPPTFPPGPYLLPPDPPTTDSEKAAAAAAAVVYGAVPVPLLGAHPLLLGGAGTSGAGG
SGASVPGKTFCCGICGRGFGRRETLKRHERIHTGEKPHQCPVCGKRFRESFHLSKHHVVH
TRERPYKCELCGKVFGYPQSLTRHRQVHRLQLPCALAGAAGLPSTQGTPGACGPGASGTS
AGPTDGLSYACSDCGEHFPDLFHVMSHKEVHMAEKPYGCDACGKTFGFIENLMWHKLVHQ
AAPERLLPPAPGGLQPPDGSSGTDAASVLDNGLAGEVGAAVAALAGVSGGEDAGGAAVAG
AGGGASSGPERFSCATCGQSFKHFLGLVTHKYVHLVRRTLGCGLCGQSFAGAYDLLLHRR
SHRQKRGFRCPVCGKRFWEAALLMRHQRCHTEQRPYRCGVCGRGFLRSWYLRQHRVVHTG
ERAFKCGVCAKRFAQSSSLAEHRRLHAVARPQRCSACGKTFRYRSNLLEHQRLHLGERAY
RCEHCGKGFFYLSSVLRHQRAHEPPRPELRCPACLKAFKDPGYFRKHLAAHQGGRPFRCS
SCGEGFANTYGLKKHRLAHKAENLGGPGAGAGTLAGKDA
NT seq 3180 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgaacccagcgggcagcggcgccgggggtggcgggagcagcggcatcgggggc
gaggacggggtgcacttccagagctaccccttcgacttcctggaattcctcaaccaccag
cgcttcgagcccatggaactgtatggggaacacgccaaggcggtggcggccctgccctgc
gcccccggccccccgccgcagcccccgccgcagccccctcccccgcagtatgactacccg
ccccagtccaccttcaagcccaaggcggaggtgccctcctcgtcctcgtcctcgtcctcc
tcctcctcctcttcgtcctcctcgtcgtcatcttcgtcctcttcctcttcccaagccaag
aagcccgatccgcccctgccgcccgccttcggggcgccccctcctcccctctttgacgct
gctttccccactccgcagtggggcatcgtggacctctcggggcaccagcacttgtttggg
aacctgaagcgaggagggcccgcgtccgggccgggggtgacgcctgggctgggcgctccc
gcgggggccccagggccgcttcctgccccctcgcagaccccgccaggaccccccgcggcg
gcggcctgcgaccccaccaaggacgacaagggctacttccggagactgaagtacctgatg
gagcggcgcttcccctgcggcgtgtgccagaagtccttcaagcagtcctcgcacctggtc
cagcacatgctggtgcactcgggggagaggccctacgaatgcggcgtctgcggccgcacc
tacaaccacgtgtccagcctcatccgccaccgccgctgccacaaggacgtgccaccggcc
gcggggggcccgccccagcccggcccccacctcccgccgctgggcctcccagcacccgct
gccagcgccgccaccgccgccgccccctccacggtgtcctcgggccctccagccacgccc
gtggcgcctgccccctccgcagacgggagcgccgcccctgctggtgttggggtgccccct
cctgccaccgggggtggcgatggcccgttcgcctgcccactctgctggaaggttttcaag
aagcccagtcacctccaccagcaccagatcatccacacgggcgagaagcccttctcctgc
tccgtgtgcagcaaaagcttcaaccgcagggagagtctgaagcgccacgtgaagacgcac
tcggccgacctcctgcgcctgccctgcggcatctgcgggaaggccttccgcgacgcctcc
tacctcctcaagcaccaggcggcccacgcgggggcgggcgccggggggcctcggcccgtg
tacccctgcgacctgtgcggcaagtcctactcggctccgcagagcctgctccgccacaag
gccgcccacgccccgcccgctgccgctgcggaggcgcccaaggacggggcggcctcggcc
ccgcagcccccgcccaccttccccccgggcccgtacctcctgccccccgaccctcccacc
acagacagcgagaaggcggcggcggccgcggcggcggtggtgtacggcgctgtgcccgtc
ccgctcctgggcgcccacccgctgctgctcggcggcgcggggaccagcggggcgggaggc
tcgggcgccagcgtcccaggaaagacgttctgctgcggcatctgcgggcgcggcttcggg
cgccgcgagaccctgaagcgccatgagcgcatccacacgggcgagaagccccaccagtgc
cccgtgtgtgggaagcgcttccgcgaatccttccacttgagcaagcatcacgtggtgcac
acgcgcgagcggccctacaagtgcgagctctgcggcaaggtcttcggctacccgcagagc
ctcacccgccaccgccaggtgcaccggctccagctgccctgcgccctggccggggcagcc
ggcctcccctccacccaaggcacaccgggggcctgtgggcccggggcctcgggcacgtct
gcagggcccaccgatgggctgagctacgcctgctcggactgcggcgagcacttcccggat
ctctttcacgtcatgagtcacaaggaggtccacatggcagagaagccatacggctgcgac
gcctgcggcaagaccttcggcttcatcgagaacctcatgtggcacaagctggtccaccag
gccgcccccgagcgcctgctcccgcccgcacccggcggcctgcagcccccggacggctcc
agcggcacggatgcggccagcgtgctggacaacgggctggcgggggaggtgggggcggcc
gtggcggcactggcaggggtgtctgggggtgaggacgcaggcggggcggcggtggcaggt
gctggcgggggtgccagttccggccccgagcgcttcagctgtgccacgtgcggccagagt
ttcaagcacttcctgggcctcgtgactcacaagtacgtgcacctggtgcgacggaccctg
ggctgcggcctctgcggccagagcttcgcgggcgcctacgacttgctcctacaccgccgc
agccatcggcagaagcggggtttccgctgcccggtgtgcgggaagcgcttctgggaggcg
gccctgctgatgcgccaccagcgctgccacacggaacagcggccgtaccgatgtggcgtg
tgcggccgaggcttcctgcgctcctggtacctgcggcagcaccgcgtggtgcacactggc
gagcgggccttcaagtgcggcgtgtgcgccaagcgcttcgcgcagtcgtccagcctggca
gagcaccggcggctgcacgctgtggcccggccccagcgctgcagcgcctgtggcaagacc
ttccgctaccgctccaacctgctggagcaccagcggctgcacctgggcgagcgcgcctac
cgctgtgagcactgcggcaagggcttcttctacctgagctccgtgctgcgccaccagcgc
gcccatgagccgccgcggcccgagctccgctgccccgcctgcctcaaggccttcaaggat
cccggctacttccgtaagcacctggctgcccaccagggcggccggcccttccgctgctcc
tcctgcggcgagggcttcgccaacacctacggcctcaagaaacaccgcctggcgcacaag
gccgagaacctcggggggcctggagcaggggcgggcaccttggccgggaaggatgcctga

DBGET integrated database retrieval system