KEGG   Homo sapiens (human): 10053
Entry
10053             CDS       T01001                                 

Gene name
AP1M2, AP1-mu2, HSMU1B, MU-1B, MU1B, mu2
Definition
(RefSeq) adaptor related protein complex 1 subunit mu 2
  KO
K12393  AP-1 complex subunit mu
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    10053 (AP1M2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    10053 (AP1M2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10053 (AP1M2)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    10053 (AP1M2)
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s Dymeclin
Other DBs
NCBI-GeneID: 10053
NCBI-ProteinID: NP_005489
OMIM: 607309
HGNC: 558
Ensembl: ENSG00000129354
Vega: OTTHUMG00000180584
Pharos: Q9Y6Q5(Tbio)
UniProt: Q9Y6Q5
LinkDB
Position
19p13.2
AA seq 423 aa
MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLLSHGQVHFLWI
KHSNLYLVATTSKNANASLVYSFLYKTIEVFCEYFKELEEESIRDNFVIVYELLDELMDF
GFPQTTDSKILQEYITQQSNKLETGKSRVPPTVTNAVSWRSEGIKYKKNEVFIDVIESVN
LLVNANGSVLLSEIVGTIKLKVFLSGMPELRLGLNDRVLFELTGRSKNKSVELEDVKFHQ
CVRLSRFDNDRTISFIPPDGDFELMSYRLSTQVKPLIWIESVIEKFSHSRVEIMVKAKGQ
FKKQSVANGVEISVPVPSDADSPRFKTSVGSAKYVPERNVVIWSIKSFPGGKEYLMRAHF
GLPSVEKEEVEGRPPIGVKFEIPYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQL
RTS
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgtccgcctcggctgtcttcattctggacgttaagggcaagccattgatcagccgcaac
tacaagggcgatgtggccatgagcaagattgagcacttcatgcctttgctggtacagcgg
gaggaggaaggcgccctggccccgctgctgagccacggccaggtccacttcctatggatc
aaacacagcaacctctacttggtggccaccacatcgaagaatgccaatgcctccctggtg
tactccttcctgtataagacaatagaggtattctgcgaatacttcaaggagctggaggag
gagagcatccgggacaactttgtcatcgtctacgagttgctggacgagctcatggacttt
ggcttcccgcagaccaccgacagcaagatcctgcaggagtacatcactcagcagagcaac
aagctggagacgggcaagtcacgggtgccacccactgtcaccaacgctgtgtcctggcgc
tccgagggtatcaagtataagaagaacgaggtcttcattgatgtcatagagtctgtcaac
ctgctggtcaatgccaacggcagcgtccttctgagcgaaatcgtcggtaccatcaagctc
aaggtgtttctgtcaggaatgccagagctgcggctgggcctcaatgaccgcgtgctcttc
gagctcactggccgcagcaagaacaaatcagtagagctggaggatgtaaaattccaccag
tgcgtgcggctctctcgctttgacaacgaccgcaccatctccttcatcccgcctgatggt
gactttgagctcatgtcataccgcctcagcacccaggtcaagccactgatctggattgag
tctgtcattgagaagttctcccacagccgcgtggagatcatggtcaaggccaaggggcag
tttaagaaacagtcagtggccaacggtgtggagatatctgtgcctgtacccagcgatgcc
gactcccccagattcaagaccagtgtgggcagcgccaagtatgtgccggagagaaacgtc
gtgatttggagtattaagtctttcccggggggcaaggagtacttgatgcgagcccacttt
ggcctccccagtgtggaaaaggaagaggtggagggccggccccccatcggggtcaagttt
gagatcccctacttcaccgtctctgggatccaggtccgatacatgaagatcattgagaaa
agtggttaccaggccctgccctgggttcgctacatcacccagagtggcgattaccaactt
cgtaccagctag

KEGG   Homo sapiens (human): 1174
Entry
1174              CDS       T01001                                 

Gene name
AP1S1, AP19, CLAPS1, EKV3, MEDNIK, SIGMA1A
Definition
(RefSeq) adaptor related protein complex 1 subunit sigma 1
  KO
K12394  AP-1 complex subunit sigma 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa05170  Human immunodeficiency virus 1 infection
Disease
H02220  MEDNIK syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    1174 (AP1S1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    1174 (AP1S1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1174 (AP1S1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    1174 (AP1S1)
SSDB
Motif
Pfam: Clat_adaptor_s DEK_C CNOT1_HEAT
Other DBs
NCBI-GeneID: 1174
NCBI-ProteinID: NP_001274
OMIM: 603531
HGNC: 559
Ensembl: ENSG00000106367
Vega: OTTHUMG00000157103
Pharos: P61966(Tbio)
UniProt: P61966 A0A024QYT6
LinkDB
Structure
PDB: 
4P6Z

Position
7q22.1
AA seq 158 aa
MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYK
RYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMG
GDVQDTSKKSVLKAIEQADLLQEEDESPRSVLEEMGLA
NT seq 477 nt   +upstreamnt  +downstreamnt
atgatgcggttcatgctattattcagccggcagggaaaactgcggctgcaaaaatggtac
ctggccacttcggacaaggaacggaagaagatggtgcgcgagctcatgcaggttgtcctg
gctcgaaagcccaagatgtgcagcttcctggagtggagggacctcaaagttgtctataag
agatatgccagcctctacttctgctgcgccatcgagggccaagacaatgagctcatcaca
ctggagctgatccaccgatacgtggagctcttagacaaatactttggcagtgtgtgcgag
ctggacatcatcttcaactttgagaaggcctacttcatcctggatgagtttttgatgggg
ggggatgtccaggacacctccaagaagagtgtgctgaaagccatcgagcaggctgaccta
ctgcaagaggaggatgagtcgccacggagtgtgctggaggagatgggtttggcatag

KEGG   Homo sapiens (human): 130340
Entry
130340            CDS       T01001                                 

Gene name
AP1S3, PSORS15
Definition
(RefSeq) adaptor related protein complex 1 subunit sigma 3
  KO
K12395  AP-1 complex subunit sigma-3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa05170  Human immunodeficiency virus 1 infection
Disease
H01656  Psoriasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    130340 (AP1S3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    130340 (AP1S3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    130340 (AP1S3)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    130340 (AP1S3)
SSDB
Motif
Pfam: Clat_adaptor_s
Other DBs
NCBI-GeneID: 130340
NCBI-ProteinID: NP_001034658
OMIM: 615781
HGNC: 18971
Ensembl: ENSG00000152056
Vega: OTTHUMG00000133165
Pharos: Q96PC3(Tdark)
UniProt: Q96PC3
LinkDB
Structure
PDB: 

Position
2q36.1
AA seq 154 aa
MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYK
RYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNVCELDIIFNFEKAYFILDEFIIG
GEIQETSKKIAVKAIEDSDMLQETMEEYMNKPTF
NT seq 465 nt   +upstreamnt  +downstreamnt
atgatacatttcatattgctcttcagtcgacaagggaaattacggctacagaaatggtac
atcactctccctgataaagagaggaagaagatcacccgggaaattgttcagattattctc
tcccgtggtcacaggacaagcagttttgttgactggaaggagctaaaacttgtttataaa
aggtatgctagtttatatttttgctgtgcaatagaaaatcaggacaatgagctcttgacg
ctagagattgtgcatcgttacgtggagctgctggacaaatattttggaaatgtctgtgag
ctggatattatctttaattttgaaaaggcttatttcatcctggacgagtttataataggt
ggggaaattcaggaaacatccaagaaaattgctgtcaaagccattgaagactctgatatg
ttacaggagacaatggaagaatacatgaacaagcctacattttaa

KEGG   Homo sapiens (human): 162
Entry
162               CDS       T01001                                 

Gene name
AP1B1, ADTB1, AP105A, BAM22, CLAPB2, KIDAR
Definition
(RefSeq) adaptor related protein complex 1 subunit beta 1
  KO
K12392  AP-1 complex subunit beta-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    162 (AP1B1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    162 (AP1B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    162 (AP1B1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    162 (AP1B1)
SSDB
Motif
Pfam: Adaptin_N Cnd1 B2-adapt-app_C HEAT_2 HEAT Alpha_adaptinC2 Cnd3 Arm RTP1_C1 CLASP_N Arm_2 API5 Transposase_22 Sec7_N
Other DBs
NCBI-GeneID: 162
NCBI-ProteinID: NP_001118
OMIM: 600157
HGNC: 554
Ensembl: ENSG00000100280
Vega: OTTHUMG00000151109
Pharos: Q10567(Tbio)
UniProt: Q10567
LinkDB
Structure
PDB: 

Position
22q12.2
AA seq 949 aa
MTDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANA
VAALSEIAESHPSSNLLDLNPQSINKLLTALNECTEWGQIFILDCLANYMPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFMEMLSKDLDYYGTLLKKLAPPLVTLLSAEPELQY
VALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRK
YPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEV
VLAEKPLISEETDLIEPTLLDELICYIGTLASVYHKPPSAFVEGGRGVVHKSLPPRTASS
ESAESPETAPTGAPPGEQPDVIPAQGDLLGDLLNLDLGPPVSGPPLATSSVQMGAVDLLG
GGLDSLMGDEPEGIGGTNFVAPPTAAVPANLGAPIGSGLSDLFDLTSGVGTLSGSYVAPK
AVWLPAMKAKGLEISGTFTRQVGSISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQ
VHAPLSPNQTVEISLPLSTVGSVMKMEPLNNLQVAVKNNIDVFYFSTLYPLHILFVEDGK
MDRQMFLATWKDIPNENEAQFQIRDCPLNAEAASSKLQSSNIFTVAKRNVEGQDMLYQSL
KLTNGIWVLAELRIQPGNPSCTDLELSLKCRAPEVSQHVYQAYETILKN
NT seq 2850 nt   +upstreamnt  +downstreamnt
atgactgactcaaaatatttcaccacgaccaagaaaggggagatcttcgagctgaaggca
gagctcaacagtgacaagaaggagaagaagaaggaggcagtgaagaaagtgattgcatcg
atgaccgtgggcaaagatgtcagtgccctcttccccgatgtggtcaactgcatgcagacg
gacaacctggagctgaagaagctagtatacctctacttgatgaattacgccaagagtcag
cctgacatggccattatggccgtcaacacctttgtgaaggactgtgaggaccccaacccc
ctcatccgagccctggcagtgcggaccatgggctgcatccgcgttgacaagatcacagag
tacctgtgcgagccactccggaagtgcctgaaggacgaggatccatatgtgcgcaagaca
gcagctgtgtgcgtggccaagctccacgacatcaacgcccagctggtggaggaccagggc
ttcctggacacccttaaagacctcatctccgactctaaccccatggtggtggccaatgca
gtggcagcgctctcagaaattgccgagtctcaccccagcagcaacctgctcgatctgaac
ccacagtccatcaacaagctgctgacagccctcaatgagtgcaccgagtggggccagatc
ttcatcctggactgcctcgccaactatatgcccaaggacgaccgcgaggcccagagcatc
tgtgagcgggtcacccccaggctctcccatgccaactccgctgtggtgctctctgctgtg
aaggtgctgatgaagttcatggagatgttgtctaaggacttggactactacggcacactg
ctcaagaagctggccccacccctggtcacactgctgtcagccgagccagagctgcagtat
gtggccctgcgcaacatcaatctcatcgtgcagaaaaggcctgagatcctgaagcatgag
atgaaggtgttcttcgtgaagtacaacgaccctatctacgtgaagctggagaagctggac
atcatgatccgcctggcctctcaggccaacatcgcccaggtgttggcagagctgaaagag
tacgcaacagaagtggatgtggactttgtacggaaggctgtgcgtgctattggccgctgc
gccatcaaggtggagcaatctgcggagcgctgtgtgagcacgctgctcgacctcatccag
accaaggtcaactatgtggtccaggaggccatcgtggtcatcaaggacatcttccgcaag
taccccaacaagtatgagagtgtgattgccacactgtgtgagaatctggactccctggat
gagcctgaggcccgggctgccatgatctggattgtgggcgagtacgcggaacggatcgac
aacgcagatgagctgctggagagcttcctcgagggcttccatgacgagagcacacaggtc
cagctgcagctgctgacagccattgtgaaactctttctaaagaagccaacagagacccag
gagctggtgcagcaggtcctcagtttggccactcaggactcagataacccagacctgcgg
gaccgtggctacatctactggcgcctgctgtccacggacccggtggcagccaaggaggtg
gtgttggctgagaagccactcatctctgaagagacggacctcatcgagcccacactgtta
gacgagcttatctgctacatcggcacgctggcttccgtctaccataagcctcccagtgcc
tttgtggaggggggccggggcgtcgtgcacaagagcctgccacctcgcacggcctcgagt
gagagcgcagagagccctgagacagcccctactggagcacctcctggggagcagccagat
gtcatccccgcccagggcgacctgctgggtgacctcctcaacctggacctcggcccccca
gtgagcggcccacccctggccacctcctcggtgcagatgggagctgtggaccttcttggc
ggtggccttgacagcctgatgggggatgagcctgaagggattgggggcaccaacttcgtg
gcacctccaacagcagcagtaccagccaatcttggagcacccatcggcagtggcctgagt
gacctctttgacctgaccagtggcgtgggcaccctgtcaggatcatatgtggcccccaaa
gcagtctggctcccagccatgaaggctaaggggctggagatctcaggcaccttcacccgc
caggtgggctccatctccatggacctgcagctgaccaacaaggccttgcaggtcatgacc
gactttgccatccagttcaaccgcaacagctttggcctggcccccgccgcccccctccag
gtccacgcgccactcagccccaaccagacagtggagatctccctgcctctcagcacggtg
ggctcggtcatgaagatggagcctctgaacaacctccaggtggccgtgaagaacaacatc
gatgtcttctacttcagcaccttgtacccactgcacatcctctttgtggaggacgggaag
atggaccggcagatgttcctggccacatggaaggatattcccaatgagaatgaggcccag
ttccagatcagagactgccccctcaatgcagaggctgcgagcagcaagctgcagagcagc
aacatcttcactgtcgccaagaggaacgtggagggccaggacatgctctaccagtccctg
aagctgaccaacggcatctgggtgctggcggagctgcggatccagccgggcaaccccagc
tgcacggacttagagctgtccctgaagtgtcgagcaccagaggtgtcccagcacgtgtac
caggcctacgagaccatcctcaagaactga

KEGG   Homo sapiens (human): 164
Entry
164               CDS       T01001                                 

Gene name
AP1G1, ADTG, CLAPG1
Definition
(RefSeq) adaptor related protein complex 1 subunit gamma 1
  KO
K12391  AP-1 complex subunit gamma-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    164 (AP1G1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    164 (AP1G1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    164 (AP1G1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    164 (AP1G1)
SSDB
Motif
Pfam: Adaptin_N Alpha_adaptinC2 Cnd1 DUF5609 Katanin_con80
Other DBs
NCBI-GeneID: 164
NCBI-ProteinID: NP_001119
OMIM: 603533
HGNC: 555
Ensembl: ENSG00000166747
Vega: OTTHUMG00000176871
Pharos: O43747(Tbio)
UniProt: O43747 Q8IY97
LinkDB
Structure
PDB: 
1IU1

Position
16q22.2
AA seq 822 aa
MPAPIRLRELIRTIRTARTQAEEREMIQKECAAIRSSFREEDNTYRCRNVAKLLYMHMLG
YPAHFGQLECLKLIASQKFTDKRIGYLGAMLLLDERQDVHLLMTNCIKNDLNHSTQFVQG
LALCTLGCMGSSEMCRDLAGEVEKLLKTSNSYLRKKAALCAVHVIRKVPELMEMFLPATK
NLLNEKNHGVLHTSVVLLTEMCERSPDMLAHFRKLVPQLVRILKNLIMSGYSPEHDVSGI
SDPFLQVRILRLLRILGRNDDDSSEAMNDILAQVATNTETSKNVGNAILYETVLTIMDIK
SESGLRVLAINILGRFLLNNDKNIRYVALTSLLKTVQTDHNAVQRHRSTIVDCLKDLDVS
IKRRAMELSFALVNGNNIRGMMKELLYFLDSCEPEFKADCASGIFLAAEKYAPSKRWHID
TIMRVLTTAGSYVRDDAVPNLIQLITNSVEMHAYTVQRLYKAILGDYSQQPLVQVAAWCI
GEYGDLLVSGQCEEEEPIQVTEDEVLDILESVLISNMSTSVTRGYALTAIMKLSTRFTCT
VNRIKKVVSIYGSSIDVELQQRAVEYNALFKKYDHMRSALLERMPVMEKVTTNGPTEIVQ
TNGETEPAPLETKPPPSGPQPTSQANDLLDLLGGNDITPVIPTAPTSKPSSAGGELLDLL
GDINLTGAPAAAPAPASVPQISQPPFLLDGLSSQPLFNDIAAGIPSITAYSKNGLKIEFT
FERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTITQ
VIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ
NT seq 2469 nt   +upstreamnt  +downstreamnt
atgccagcccccatcagattgcgggagctgatccggaccatccggacagcccgaacccaa
gctgaagaacgagaaatgatccagaaagaatgtgctgcaatccggtcatcttttagagaa
gaagacaatacataccgatgtcggaatgtggcaaaattactgtatatgcacatgctgggc
taccctgctcactttggacagttggagtgcctcaagcttattgcctctcaaaaatttaca
gacaaacgcattggctatttaggggcaatgctgctgttagatgaaagacaagatgtccat
cttctcatgaccaactgtatcaagaatgatcttaatcatagcacgcaattcgtacagggg
ttagcactttgtaccctcggctgcatgggctcctcagagatgtgcagagatcttgcagga
gaggtagagaagctcctgaaaacctccaactcttacttaagaaaaaaggcagcactgtgt
gctgttcatgtcatcaggaaagttcctgaacttatggagatgtttttaccagcaacaaaa
aatttattgaatgagaagaaccatggtgtcctccacacatctgtagtcctcctcacagaa
atgtgtgagcgaagcccagacatgcttgcgcatttcagaaagcttgtgccccaattagtt
cgtattttaaagaacctcatcatgtccggatattcaccagaacatgatgtttctggtatc
agtgacccctttttgcaggtacgaattttgcggttattaagaattttaggacgaaatgat
gatgattcaagtgaagctatgaatgatatattagcacaggttgccactaatactgagact
agtaaaaatgtaggaaatgctattctttatgaaacggttttgactatcatggatattaag
tcagagagtggattgcgagtcctagccataaatatcctgggtcgtttcttattgaacaat
gacaagaatattagatatgtggctctgacatctttgttgaagactgtacagacagatcat
aatgcagtacagaggcacagaagcacaattgtggactgtcttaaagatttggatgtctca
ataaaacggcgtgcaatggaattgagttttgccctggtaaatgggaataatatccgaggc
atgatgaaagaattactttattttctggattcgtgtgagccagaatttaaagcagactgt
gcatctggaatctttcttgctgcagaaaagtatgcaccttccaaacgatggcatatagac
acaattatgcgtgttttgacaacggcaggaagttatgttcgtgatgatgcagtccccaat
ttaatccagttaataactaatagtgtggagatgcatgcctatactgtccagcgcctgtac
aaagcaattcttggtgattattctcaacaacctttggtacaagtggctgcatggtgtata
ggtgaatatggtgatcttcttgtatctggccagtgtgaagaggaagagcctattcaggta
acagaggatgaagtgttggatattttagaaagtgtcctaatctctaatatgtccacctct
gtgacacgaggttatgccctcactgccattatgaagctttccactcgattcacttgtact
gtaaaccgaattaagaaagtggtttccatctacggaagcagcattgatgtggaactccag
cagagggcagtagaatataatgcacttttcaagaaatatgaccacatgaggtctgcccta
cttgagagaatgcctgtcatggaaaaagtgaccacaaatggccctactgagattgtgcag
acaaatggagagacagaaccagctccactagagaccaaaccgccaccctctgggccacag
cccaccagccaggccaatgatttattggatttgttgggaggaaatgacataacacctgtt
attccaactgcgcctacaagcaaaccatcttctgctggtggagaacttcttgatttgctg
ggagacatcaaccttacaggtgctccagctgctgctcctgcccctgcctcagtcccacag
atatcccagccccccttcttgttggatgggctttcatcacagcctctcttcaatgatatt
gctgcaggcatcccctccatcacagcatacagtaagaatggcttgaagatagaattcacc
tttgaacggtcaaataccaaccccagtgtaacagtgataacgatacaggcctccaacagc
acagagctagatatgacggactttgttttccaagctgcagtaccaaagacattccagctg
cagctcttgtctcctagcagcagcattgtcccagcatttaacacggggaccatcacacaa
gtcattaaagttctgaaccctcagaagcaacagctgcgaatgcggatcaagcttacatat
aatcacaagggctcagcaatgcaagatctagcagaggtgaacaactttccccctcagtcc
tggcaatga

KEGG   Homo sapiens (human): 8905
Entry
8905              CDS       T01001                                 

Gene name
AP1S2, DC22, MRX59, MRXS21, MRXS5, MRXSF, PGS, SIGMA1B
Definition
(RefSeq) adaptor related protein complex 1 subunit sigma 2
  KO
K12394  AP-1 complex subunit sigma 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    8905 (AP1S2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    8905 (AP1S2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8905 (AP1S2)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    8905 (AP1S2)
SSDB
Motif
Pfam: Clat_adaptor_s PulA_N1
Other DBs
NCBI-GeneID: 8905
NCBI-ProteinID: NP_003907
OMIM: 300629
HGNC: 560
Ensembl: ENSG00000182287
Vega: OTTHUMG00000021186
Pharos: P56377(Tbio)
UniProt: P56377 Q549M9
LinkDB
Position
Xp22.2
AA seq 157 aa
MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKR
YASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGG
EVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT
NT seq 474 nt   +upstreamnt  +downstreamnt
atgcagtttatgttgctttttagtcgtcagggaaagcttcgactgcaaaaatggtatgtc
ccactatcagacaaagagaagaaaaagatcacaagagaacttgttcagaccgttttagca
cggaaacctaaaatgtgcagcttccttgagtggcgagatctgaagattgtttacaaaaga
tatgctagtctgtatttttgctgtgctattgaggatcaggacaatgaactaattaccctg
gaaataattcatcgttatgtggaattacttgacaagtatttcggcagtgtctgtgaacta
gatatcatctttaattttgagaaggcttattttattttggatgagtttcttttgggaggg
gaagttcaggaaacatccaagaaaaatgtccttaaagcaattgagcaggctgatctactg
caggaggaagctgaaaccccacgtagtgttcttgaagaaattggactgacataa

KEGG   Homo sapiens (human): 8906
Entry
8906              CDS       T01001                                 

Gene name
AP1G2, G2AD
Definition
(RefSeq) adaptor related protein complex 1 subunit gamma 2
  KO
K12391  AP-1 complex subunit gamma-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    8906 (AP1G2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    8906 (AP1G2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8906 (AP1G2)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    8906 (AP1G2)
SSDB
Motif
Pfam: Adaptin_N Alpha_adaptinC2 Cnd1 DUF5609 Proteasom_PSMB
Other DBs
NCBI-GeneID: 8906
NCBI-ProteinID: NP_003908
OMIM: 603534
HGNC: 556
Ensembl: ENSG00000213983
Vega: OTTHUMG00000028760
Pharos: O75843(Tbio)
UniProt: O75843
LinkDB
Structure
PDB: 
3ZHF 2YMT 4BCX 2E9G

Position
14q11.2
AA seq 785 aa
MVVPSLKLQDLIEEIRGAKTQAQEREVIQKECAHIRASFRDGDPVHRHRQLAKLLYVHML
GYPAHFGQMECLKLIASSRFTDKRVGYLGAMLLLDERHDAHLLITNSIKNDLSQGIQPVQ
GLALCTLSTMGSAEMCRDLAPEVEKLLLQPSPYVRKKAILTAVHMIRKVPELSSVFLPPC
AQLLHERHHGILLGTITLITELCERSPAALRHFRKVVPQLVHILRTLVTMGYSTEHSISG
VSDPFLQVQILRLLRILGRNHEESSETMNDLLAQVATNTDTSRNAGNAVLFETVLTIMDI
RSAAGLRVLAVNILGRFLLNSDRNIRYVALTSLLRLVQSDHSAVQRHRPTVVECLRETDA
SLSRRALELSLALVNSSNVRAMMQELQAFLESCPPDLRADCASGILLAAERFAPTKRWHI
DTILHVLTTAGTHVRDDAVANLTQLIGGAQELHAYSVRRLYNALAEDISQQPLVQVAAWC
IGEYGDLLLAGNCEEIEPLQVDEEEVLALLEKVLQSHMSLPATRGYALTALMKLSTRLCG
DNNRIRQVVSIYGSCLDVELQQRAVEYDTLFRKYDHMRAAILEKMPLVERDGPQADEEAK
ESKEAAQLSEAAPVPTEPQASQLLDLLDLLDGASGDVQHPPHLDPSPGGALVHLLDLPCV
PPPPAPIPDLKVFEREGVQLNLSFIRPPENPALLLITITATNFSEGDVTHFICQAAVPKS
LQLQLQAPSGNTVPARGGLPITQLFRILNPNKAPLRLKLRLTYDHFHQSVQEIFEVNNLP
VESWQ
NT seq 2358 nt   +upstreamnt  +downstreamnt
atggtggtgccttcgctgaagcttcaggacctcatcgaagagattcgcggggccaagact
caggcccaggagcgggaggtgatccaaaaggagtgtgcccacatccgggcctccttccgc
gacggggacccagtgcacaggcaccggcagctggccaaactgctctacgtccacatgttg
ggctaccccgcccactttggacagatggagtgcctgaaactgatcgcctcctccagattc
acagacaagagggtgggctacctgggggccatgcttctattggatgagaggcacgatgcc
cacctgctcattaccaacagcatcaagaatgacctgagccaggggattcagccagtacaa
ggcctggccttgtgcactttgagcaccatgggctctgctgagatgtgccgagacctggcc
ccagaggtggagaaactgctcctgcagcccagtccctacgtgcgcaagaaggctattctg
actgcagtgcacatgatccggaaggtccctgaactctccagtgtcttcctcccaccctgt
gcccaactgcttcatgagcgtcaccatggcatcctgctgggcaccatcacgctgatcacg
gagctctgcgaacgaagccctgcagccctcaggcacttccgaaaggtggtaccccagctg
gtacacatcctccggactctggtgacaatgggatactccacagaacacagcatatctgga
gtcagcgaccccttcctgcaggtccagatacttcgtctgcttcggatcctgggccggaac
cacgaggagagcagtgagaccatgaatgacttgctggcccaggtggccactaacacggac
accagccgaaatgccggaaatgcggtcctgtttgagacagtactcaccatcatggatatc
cgctctgcagctggcctacgggttctagctgtcaacattcttggtcgcttcctactcaac
agtgacaggaacattaggtatgtagccctgacatcactgcttcgactggtgcagtctgat
cacagtgctgtgcagcggcatcggcccactgtggtggaatgtctacgggaaactgatgcc
tccctcagccggagagccctggaactaagcctggctctggtaaatagctccaatgtgcga
gccatgatgcaagagctgcaggcctttctggagtcctgccctcctgacctacgggctgac
tgtgcctcaggcatcctgctggctgcagagaggtttgctccaaccaaacgctggcacata
gacaccatcctgcatgtgctgacaacggcgggcacccatgtgcgggatgatgcagtggcc
aacctgacccagctgattgggggggcccaggagctacatgcctactctgtgcgccgcctc
tacaatgccctggcagaagacatttcccagcaaccactggtgcaggtggcagcctggtgc
attggggagtatggggacctcctgctggcagggaactgcgaggagattgagccccttcag
gtggacgaagaggaagtgctggcattgctggaaaaggtgctgcagtcccacatgtccctg
ccagccactcgaggatatgccctcacagccctcatgaagctcagcactcgcctctgtggg
gacaacaaccgcatccgccaggtggtgtccatctacgggagctgcttggacgtggagctg
cagcagcgggctgtggagtatgacacactcttccggaaatacgaccacatgagggctgcc
atcctggaaaaaatgcctcttgtggagcgagatggccctcaggctgatgaggaagcaaag
gaaagcaaagaagcagcccagctttcagaagcagccccagtgcccacagagccccaggcc
tcacagctcctggatctgctagatctcctggatggggcttctggggatgtccagcatcct
ccccatctggacccctccccaggaggtgccctggtacacctgcttgaccttccctgtgta
cctccacccccagctcccatcccagatctcaaagtgtttgagcgtgagggagtacagctg
aatctgtctttcattcgaccccctgaaaaccctgctttgctgttaatcaccatcactgcc
accaacttctcagagggtgatgtcacccatttcatctgccaggctgctgtgcccaagagt
ctccagctgcagctgcaggcccccagtgggaacacagttccagctcggggtggccttcct
atcacccagctcttcagaatcctcaatcctaacaaggcccccctgcggctaaagctgcgc
ctcacctacgaccactttcaccagtcggtgcaggagatctttgaggtgaacaacttgcct
gtggaatcgtggcagtaa

KEGG   Homo sapiens (human): 8907
Entry
8907              CDS       T01001                                 

Gene name
AP1M1, AP47, CLAPM2, CLTNM, MU-1A
Definition
(RefSeq) adaptor related protein complex 1 subunit mu 1
  KO
K12393  AP-1 complex subunit mu
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    8907 (AP1M1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    8907 (AP1M1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8907 (AP1M1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    8907 (AP1M1)
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s DUF5482 muHD
Other DBs
NCBI-GeneID: 8907
NCBI-ProteinID: NP_115882
OMIM: 603535
HGNC: 13667
Ensembl: ENSG00000072958
Vega: OTTHUMG00000182323
Pharos: Q9BXS5(Tbio)
UniProt: Q9BXS5 A0A024R7K8 B3KNH5
LinkDB
Position
19p13.11
AA seq 423 aa
MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWI
KHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDF
GYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIESVN
LLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQ
CVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQ
FKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHF
GLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQL
RTQ
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgtccgccagcgccgtctacgtgctggacctgaagggcaaggtgctcatctgccggaac
taccgtggcgacgtggacatgtcagaggtggagcacttcatgcccatcctgatggagaag
gaggaggaggggatgctgtcgcccatcctggcccacgggggggtccgtttcatgtggatc
aaacacaacaacctgtatctggttgccacatccaagaagaacgcgtgcgtgtcgctggtc
ttttctttcctctataaggtggtgcaggtgttttccgagtacttcaaggagctggaggag
gagagcatccgggacaactttgttatcatctacgagctgctggacgagctcatggacttc
ggctacccccagaccaccgacagcaagatcctgcaggagtacatcactcaggaaggccac
aagctggaaacaggggccccgcggccaccagccaccgtcaccaacgcggtgtcctggcgg
tccgaaggcatcaagtatcggaagaatgaggtgttcttggacgtcatcgagtctgtcaac
ctcttggtcagcgccaacggcaatgtcctgcgcagcgagatcgtgggctccatcaagatg
cgagtcttcctctcgggcatgcccgagctgcgcctgggcctcaacgacaaggtcctcttt
gacaacacgggccgcggcaaaagcaaatccgtggagctggaggatgtgaagttccaccag
tgtgtgcggctatcacgcttcgagaatgaccgcaccatctccttcatcccacccgacggc
gagttcgagctcatgtcctaccgtctcaacacccacgtcaagcctttgatatggatcgag
tcggtgatcgagaagcactcccacagccgcatcgagtacatgatcaaggccaaaagccag
ttcaagcggcggtcaacagccaacaacgtggagatccacattcccgtgcccaatgatgcc
gactcacccaagttcaagacgacggtggggagcgttaagtgggtccccgagaacagcgag
atcgtgtggtccatcaagtccttcccgggcggcaaggagtacctgatgcgggcccacttc
ggcctgcctagtgtggaggccgaagacaaggagggcaagcccccgatcagtgtcaagttc
gagatcccttacttcactacctccggcatccaggtgcgctacctgaagatcattgagaag
agtgggtaccaggccctgccctgggtgcgttatatcacgcagaatggagattaccagctc
cggacccagtga

DBGET integrated database retrieval system