KEGG   Homo sapiens (human): 100533105Help
Entry
100533105         CDS       T01001                                 

Gene name
C8orf44-SGK3
Definition
(RefSeq) C8orf44-SGK3 readthrough
  KO
K13304  serum/glucocorticoid-regulated kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100533105 (C8orf44-SGK3)
   04151 PI3K-Akt signaling pathway
    100533105 (C8orf44-SGK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    100533105 (C8orf44-SGK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100533105 (C8orf44-SGK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   100533105 (C8orf44-SGK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PX Pkinase_C Kinase-like FTA2 Kdo Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 100533105
NCBI-ProteinID: NP_001191102
HGNC: 48354
Ensembl: ENSG00000104205
Vega: OTTHUMG00000183957
UniProt: Q96BR1 A0A024R807
LinkDB All DBs
Structure
PDB: 

Position
8q13.1
AA seq 496 aa AA seqDB search
MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNT
LKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMD
SPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAK
RKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVL
DFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHV
VLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPP
FYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFE
SLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADD
AFVGFSYAPPSEDLFL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagagatcacaccatggactacaaggaaagctgcccaagtgtaagcattcccagc
tccgatgaacacagagagaaaaagaagaggtttactgtttataaagttctggtttcagtg
ggaagaagtgaatggtttgtcttcaggagatatgcagagtttgataaactttataacact
ttaaaaaaacagtttcctgctatggccctgaagattcctgccaagagaatatttggtgat
aattttgatccagattttattaaacaaagacgagcaggactaaacgaattcattcagaac
ctagttaggtatccagaactttataaccatccagatgtcagagcattccttcaaatggac
agtccaaaacaccagtcagatccatctgaagatgaggatgaaagaagttctcagaagcta
cactctacctcacagaacatcaacctgggaccgtctggaaatcctcatgccaaaccaact
gactttgatttcttaaaagttattggaaaaggcagctttggcaaggttcttcttgcaaaa
cggaaactggatggaaaattttatgctgtcaaagtgttacagaaaaaaatagttctcaac
agaaaagagcaaaaacatattatggctgaacgtaatgtgctcttgaaaaatgtgaaacat
ccgtttttggttggattgcattattccttccaaacaactgaaaagctttattttgttctg
gattttgttaatggaggggagctttttttccacttacaaagagaacggtcctttcctgag
cacagagctaggttttacgctgctgaaattgctagtgcattgggttacttacattccatc
aaaatagtatacagagacttgaaaccagaaaatattcttttggattcagtaggacatgtt
gtcttaacagattttgggctttgtaaagaaggaattgctatttctgacaccactaccaca
ttttgtgggacaccagagtatcttgcacctgaagtaattagaaaacagccctatgacaat
actgtagattggtggtgccttggggctgttctgtatgaaatgctgtatggattgcctcct
ttttattgccgagatgttgctgaaatgtatgacaatatccttcacaaacccctaagtttg
aggccaggagtgagtcttacagcctggtccattctggaagaactcctagaaaaagacagg
caaaatcgacttggtgccaaggaagactttcttgaaattcagaatcatcctttttttgaa
tcactcagctgggctgaccttgtacaaaagaagattccaccaccatttaatcctaatgtg
gctggaccagatgatatcagaaactttgacacagcatttacagaagaaacagttccatat
tctgtgtgtgtatcttctgactattctatagtgaatgccagtgtattggaggcagatgat
gcattcgttggtttctcttatgcacctccttcagaagacttatttttgtga

KEGG   Homo sapiens (human): 10110Help
Entry
10110             CDS       T01001                                 

Gene name
SGK2, H-SGK2, dJ138B7.2
Definition
(RefSeq) serum/glucocorticoid regulated kinase 2
  KO
K13303  serum/glucocorticoid-regulated kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    10110 (SGK2)
   04151 PI3K-Akt signaling pathway
    10110 (SGK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    10110 (SGK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     10110 (SGK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   10110 (SGK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_C Kdo
Motif
Other DBs
NCBI-GeneID: 10110
NCBI-ProteinID: NP_057360
OMIM: 607589
HGNC: 13900
Ensembl: ENSG00000101049
Vega: OTTHUMG00000033054
Pharos: Q9HBY8(Tbio)
UniProt: Q9HBY8
LinkDB All DBs
Position
20q13.12
AA seq 427 aa AA seqDB search
MQGLLTSGRKPSGGGRCTGRGGWRGQWCLKPWMGGADPPTPTLSCLLLPVPPELPDHCYR
MNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAF
YAVKVLQKKSILKKKEQSHIMAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGE
LFFHLQRERRFLEPRARFYAAEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGL
CKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVS
QMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHVFFSPINWDDL
YHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPE
DDDILDC
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggttgcttacctcgggtaggaaaccctcaggcggtggcaggtgcacaggtagg
ggaggatggagagggcagtggtgcctgaagccctggatgggcggagctgaccccccaaca
ccaactctctcatgcctgctcctccctgtccccccagagctgcctgatcattgctacaga
atgaactctagcccagctgggaccccaagtccacagccctccagggccaatgggaacatc
aacctggggccttcagccaacccaaatgcccagcccacggacttcgacttcctcaaagtc
atcggcaaagggaactacgggaaggtcctactggccaagcgcaagtctgatggggcgttc
tatgcagtgaaggtactacagaaaaagtccatcttaaagaagaaagagcagagccacatc
atggcagagcgcagtgtgcttctgaagaacgtgcggcaccccttcctcgtgggcctgcgc
tactccttccagacacctgagaagctctacttcgtgctcgactatgtcaacgggggagag
ctcttcttccacctgcagcgggagcgccggttcctggagccccgggccaggttctacgct
gctgaggtggccagcgccattggctacctgcactccctcaacatcatttacagggatctg
aaaccagagaacattctcttggactgccagggacacgtggtgctgacggattttggcctc
tgcaaggaaggtgtagagcctgaagacaccacatccacattctgtggtacccctgagtac
ttggcacctgaagtgcttcggaaagagccttatgatcgagcagtggactggtggtgcttg
ggggcagtcctctacgagatgctccatggcctgccgcccttctacagccaagatgtatcc
cagatgtatgagaacattctgcaccagccgctacagatccccggaggccggacagtggcc
gcctgtgacctcctgcaaagccttctccacaaggaccagaggcagcggctgggctccaaa
gcagactttcttgagattaagaaccatgtattcttcagccccataaactgggatgacctg
taccacaagaggctaactccacccttcaacccaaatgtgacaggacctgctgacttgaag
cattttgacccagagttcacccaggaagctgtgtccaagtccattggctgtacccctgac
actgtggccagcagctctggggcctcaagtgcattcctgggattttcttatgcgccagag
gatgatgacatcttggattgctag

KEGG   Homo sapiens (human): 23678Help
Entry
23678             CDS       T01001                                 

Gene name
SGK3, CISK, SGK2, SGKL
Definition
(RefSeq) serum/glucocorticoid regulated kinase family member 3
  KO
K13304  serum/glucocorticoid-regulated kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    23678 (SGK3)
   04151 PI3K-Akt signaling pathway
    23678 (SGK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    23678 (SGK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     23678 (SGK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   23678 (SGK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PX Pkinase_C Kinase-like FTA2 Kdo Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 23678
NCBI-ProteinID: NP_001028750
OMIM: 607591
HGNC: 10812
Ensembl: ENSG00000104205
Vega: OTTHUMG00000164561
Pharos: Q96BR1(Tbio)
UniProt: Q96BR1 A0A024R807 Q5H9Q5
LinkDB All DBs
Structure
PDB: 

Position
8q13.1
AA seq 496 aa AA seqDB search
MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNT
LKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMD
SPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAK
RKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVL
DFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHV
VLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPP
FYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFE
SLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADD
AFVGFSYAPPSEDLFL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagagatcacaccatggactacaaggaaagctgcccaagtgtaagcattcccagc
tccgatgaacacagagagaaaaagaagaggtttactgtttataaagttctggtttcagtg
ggaagaagtgaatggtttgtcttcaggagatatgcagagtttgataaactttataacact
ttaaaaaaacagtttcctgctatggccctgaagattcctgccaagagaatatttggtgat
aattttgatccagattttattaaacaaagacgagcaggactaaacgaattcattcagaac
ctagttaggtatccagaactttataaccatccagatgtcagagcattccttcaaatggac
agtccaaaacaccagtcagatccatctgaagatgaggatgaaagaagttctcagaagcta
cactctacctcacagaacatcaacctgggaccgtctggaaatcctcatgccaaaccaact
gactttgatttcttaaaagttattggaaaaggcagctttggcaaggttcttcttgcaaaa
cggaaactggatggaaaattttatgctgtcaaagtgttacagaaaaaaatagttctcaac
agaaaagagcaaaaacatattatggctgaacgtaatgtgctcttgaaaaatgtgaaacat
ccgtttttggttggattgcattattccttccaaacaactgaaaagctttattttgttctg
gattttgttaatggaggggagctttttttccacttacaaagagaacggtcctttcctgag
cacagagctaggttttacgctgctgaaattgctagtgcattgggttacttacattccatc
aaaatagtatacagagacttgaaaccagaaaatattcttttggattcagtaggacatgtt
gtcttaacagattttgggctttgtaaagaaggaattgctatttctgacaccactaccaca
ttttgtgggacaccagagtatcttgcacctgaagtaattagaaaacagccctatgacaat
actgtagattggtggtgccttggggctgttctgtatgaaatgctgtatggattgcctcct
ttttattgccgagatgttgctgaaatgtatgacaatatccttcacaaacccctaagtttg
aggccaggagtgagtcttacagcctggtccattctggaagaactcctagaaaaagacagg
caaaatcgacttggtgccaaggaagactttcttgaaattcagaatcatcctttttttgaa
tcactcagctgggctgaccttgtacaaaagaagattccaccaccatttaatcctaatgtg
gctggaccagatgatatcagaaactttgacacagcatttacagaagaaacagttccatat
tctgtgtgtgtatcttctgactattctatagtgaatgccagtgtattggaggcagatgat
gcattcgttggtttctcttatgcacctccttcagaagacttatttttgtga

KEGG   Homo sapiens (human): 6446Help
Entry
6446              CDS       T01001                                 

Gene name
SGK1, SGK
Definition
(RefSeq) serum/glucocorticoid regulated kinase 1
  KO
K13302  serum/glucocorticoid-regulated kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    6446 (SGK1)
   04151 PI3K-Akt signaling pathway
    6446 (SGK1)
   04150 mTOR signaling pathway
    6446 (SGK1)
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    6446 (SGK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6446 (SGK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6446 (SGK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   6446 (SGK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_C FTA2 Kdo Haspin_kinase PX APH Pacs-1
Motif
Other DBs
NCBI-GeneID: 6446
NCBI-ProteinID: NP_005618
OMIM: 602958
HGNC: 10810
Ensembl: ENSG00000118515
Vega: OTTHUMG00000015613
Pharos: O00141(Tchem)
UniProt: O00141
LinkDB All DBs
Structure
PDB: 

Position
6q23.2
AA seq 431 aa AA seqDB search
MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKI
SQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE
EVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYIN
GGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTD
FGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSR
NTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINW
DDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLG
FSYAPPTDSFL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgaaaactgaggctgctaagggcaccctcacttactccaggatgaggggcatg
gtggcaattctcatcgctttcatgaagcagaggaggatgggtctgaacgactttattcag
aagattgccaataactcctatgcatgcaaacaccctgaagttcagtccatcttgaagatc
tcccaacctcaggagcctgagcttatgaatgccaacccttctcctccaccaagtccttct
cagcaaatcaaccttggcccgtcgtccaatcctcatgctaaaccatctgactttcacttc
ttgaaagtgatcggaaagggcagttttggaaaggttcttctagcaagacacaaggcagaa
gaagtgttctatgcagtcaaagttttacagaagaaagcaatcctgaaaaagaaagaggag
aagcatattatgtcggagcggaatgttctgttgaagaatgtgaagcaccctttcctggtg
ggccttcacttctctttccagactgctgacaaattgtactttgtcctagactacattaat
ggtggagagttgttctaccatctccagagggaacgctgcttcctggaaccacgggctcgt
ttctatgctgctgaaatagccagtgccttgggctacctgcattcactgaacatcgtttat
agagacttaaaaccagagaatattttgctagattcacagggacacattgtccttactgac
ttcggactctgcaaggagaacattgaacacaacagcacaacatccaccttctgtggcacg
ccggagtatctcgcacctgaggtgcttcataagcagccttatgacaggactgtggactgg
tggtgcctgggagctgtcttgtatgagatgctgtatggcctgccgcctttttatagccga
aacacagctgaaatgtacgacaacattctgaacaagcctctccagctgaaaccaaatatt
acaaattccgcaagacacctcctggagggcctcctgcagaaggacaggacaaagcggctc
ggggccaaggatgacttcatggagattaagagtcatgtcttcttctccttaattaactgg
gatgatctcattaataagaagattactcccccttttaacccaaatgtgagtgggcccaac
gacctacggcactttgaccccgagtttaccgaagagcctgtccccaactccattggcaag
tcccctgacagcgtcctcgtcacagccagcgtcaaggaagctgccgaggctttcctaggc
ttttcctatgcgcctcccacggactctttcctctga

DBGET integrated database retrieval system