KEGG   Homo sapiens (human): 100861540
Entry
100861540         CDS       T01001                                 

Gene name
CYP3A7-CYP3A51P, CYP3A7, CYP3A7-3AP1, CYP3A7-CYP3AP1, CYP3A7.1L, CYPIIIA7
Definition
(RefSeq) CYP3A7-CYP3A51P readthrough
  KO
K17691  cytochrome P450 family 3 subfamily A polypeptide 7 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100861540 (CYP3A7-CYP3A51P)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100861540 (CYP3A7-CYP3A51P)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100861540 (CYP3A7-CYP3A51P)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    100861540 (CYP3A7-CYP3A51P)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100861540 (CYP3A7-CYP3A51P)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP3 family
   100861540 (CYP3A7-CYP3A51P)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 100861540
NCBI-ProteinID: NP_001243426
HGNC: 51504
Ensembl: ENSG00000282301
Vega: OTTHUMG00000191417
UniProt: P24462
LinkDB
Position
7q22.1
AA seq 535 aa
MDLIPNLAVETWLLLAVSLILLYLYGTRTHGLFKKLGIPGPTPLPFLGNALSFRKGYWTF
DMECYKKYRKVWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKNAISI
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKHVFGAYS
MDVITSTSFGVSIDSLNNPQDPFVENTKKLLRFNPLDPFVLSIKVFPFLTPILEALNITV
FPRKVISFLTKSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI
IFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPPTYDTVLQLEYLDMVV
NETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWTEPEKFLPERFS
KKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFG
GLLLTEKPIVLKAESRDETFVDMEPIHMDFLRSLAFQGPHLCFFWELLCPTIRSR
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggatctcatcccaaacttggccgtggaaacctggcttctcctggctgtcagcctgata
ctcctctatctatatggaacccgtacacatggactttttaagaagcttggaattccaggg
cccacacctctgccttttttgggaaatgctttgtccttccgtaagggctattggacgttt
gacatggaatgttataaaaagtatagaaaagtctggggtatttatgactgtcaacagcct
atgctggctatcacagatcccgacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggcctttcgggccagtgggatttatgaaaaatgccatctctata
gctgaggatgaagaatggaagagaatacgatcattgctgtctccaacattcaccagcgga
aaactcaaggagatggtccctatcattgcccagtatggagatgtgttggtgagaaatctg
aggcgggaagcagagacaggcaagcctgtcaccttgaaacacgtctttggggcctacagc
atggatgtgatcactagcacatcatttggagtgagcatcgactctctcaacaatccacaa
gacccctttgtggaaaacaccaagaagcttttaagatttaatccattagatccattcgtt
ctctcaataaaagtctttccattccttaccccaattcttgaagcattaaatatcactgtg
tttccaagaaaagttataagttttctaacaaaatctgtaaaacagataaaagaaggtcgc
ctcaaagagacacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcaaaagactctgagacccacaaagctctgtctgatctggagctcatggcccaatcaatt
atctttatttttgctggctatgaaaccacgagcagtgttctctccttcattatatatgaa
ctggccactcaccctgatgtccagcagaaagtgcagaaggaaattgatacagttttaccc
aataaggcaccacccacctatgatactgtgctacagttggagtatcttgacatggtggtg
aatgaaacactcagattattcccagttgctatgagacttgagagggtctgcaaaaaagat
gttgaaatcaatgggatgtttattcccaaaggggtggtggtgatgattccaagctatgtt
cttcatcatgacccaaagtactggacagagcctgagaagttcctccctgaaaggttcagt
aaaaagaacaaggacaacatagatccttacatatacacaccctttggaagtggacccaga
aactgcattggcatgaggtttgctctcgtgaacatgaaacttgctctagtcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatccccctgaaattacgctttgga
ggacttcttctaacagaaaaacccattgttctaaaggctgagtcaagggatgagaccttt
gtagatatggagcccattcacatggactttttaagaagcttggcattccagggcccacac
ctctgctttttttgggaactactttgtcctaccatcagatcccgctga

KEGG   Homo sapiens (human): 1551
Entry
1551              CDS       T01001                                 

Gene name
CYP3A7, CP37, CYPIIIA7, P-450(HFL33), P-450111A7, P450-HFLA, P450HLp2
Definition
(RefSeq) cytochrome P450 family 3 subfamily A member 7
  KO
K17691  cytochrome P450 family 3 subfamily A polypeptide 7 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Drug target
Cobicistat: D09881
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    1551 (CYP3A7)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    1551 (CYP3A7)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    1551 (CYP3A7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1551 (CYP3A7)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     1551 (CYP3A7)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP3 family
   1551 (CYP3A7)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 1551
NCBI-ProteinID: NP_000756
OMIM: 605340
HGNC: 2640
Ensembl: ENSG00000160870
Vega: OTTHUMG00000156726
Pharos: P24462(Tclin)
UniProt: P24462
LinkDB
Position
7q22.1
AA seq 503 aa
MDLIPNLAVETWLLLAVSLILLYLYGTRTHGLFKKLGIPGPTPLPFLGNALSFRKGYWTF
DMECYKKYRKVWGIYDCQQPMLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKNAISI
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKHVFGAYS
MDVITSTSFGVSIDSLNNPQDPFVENTKKLLRFNPLDPFVLSIKVFPFLTPILEALNITV
FPRKVISFLTKSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI
IFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPPTYDTVLQLEYLDMVV
NETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWTEPEKFLPERFS
KKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRFG
GLLLTEKPIVLKAESRDETVSGA
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggatctcatcccaaacttggccgtggaaacctggcttctcctggctgtcagcctgata
ctcctctatctatatggaacccgtacacatggactttttaagaagcttggaattccaggg
cccacacctctgccttttttgggaaatgctttgtccttccgtaagggctattggacgttt
gacatggaatgttataaaaagtatagaaaagtctggggtatttatgactgtcaacagcct
atgctggctatcacagatcccgacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggcctttcgggccagtgggatttatgaaaaatgccatctctata
gctgaggatgaagaatggaagagaatacgatcattgctgtctccaacattcaccagcgga
aaactcaaggagatggtccctatcattgcccagtatggagatgtgttggtgagaaatctg
aggcgggaagcagagacaggcaagcctgtcaccttgaaacacgtctttggggcctacagc
atggatgtgatcactagcacatcatttggagtgagcatcgactctctcaacaatccacaa
gacccctttgtggaaaacaccaagaagcttttaagatttaatccattagatccattcgtt
ctctcaataaaagtctttccattccttaccccaattcttgaagcattaaatatcactgtg
tttccaagaaaagttataagttttctaacaaaatctgtaaaacagataaaagaaggtcgc
ctcaaagagacacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcaaaagactctgagacccacaaagctctgtctgatctggagctcatggcccaatcaatt
atctttatttttgctggctatgaaaccacgagcagtgttctctccttcattatatatgaa
ctggccactcaccctgatgtccagcagaaagtgcagaaggaaattgatacagttttaccc
aataaggcaccacccacctatgatactgtgctacagttggagtatcttgacatggtggtg
aatgaaacactcagattattcccagttgctatgagacttgagagggtctgcaaaaaagat
gttgaaatcaatgggatgtttattcccaaaggggtggtggtgatgattccaagctatgtt
cttcatcatgacccaaagtactggacagagcctgagaagttcctccctgaaaggttcagt
aaaaagaacaaggacaacatagatccttacatatacacaccctttggaagtggacccaga
aactgcattggcatgaggtttgctctcgtgaacatgaaacttgctctagtcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatccccctgaaattacgctttgga
ggacttcttctaacagaaaaacccattgttctaaaggctgagtcaagggatgagaccgta
agtggagcctga

KEGG   Homo sapiens (human): 1577
Entry
1577              CDS       T01001                                 

Gene name
CYP3A5, CP35, CYPIIIA5, P450PCN3, PCN3
Definition
(RefSeq) cytochrome P450 family 3 subfamily A member 5
  KO
K17690  cytochrome P450 family 3 subfamily A polypeptide 5 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Drug target
Cobicistat: D09881
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    1577 (CYP3A5)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    1577 (CYP3A5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    1577 (CYP3A5)
   00982 Drug metabolism - cytochrome P450
    1577 (CYP3A5)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    1577 (CYP3A5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1577 (CYP3A5)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     1577 (CYP3A5)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP3 family
   1577 (CYP3A5)
SSDB
Motif
Pfam: p450 Coa1
Other DBs
NCBI-GeneID: 1577
NCBI-ProteinID: NP_000768
OMIM: 605325
HGNC: 2638
Ensembl: ENSG00000106258
Vega: OTTHUMG00000156724
Pharos: P20815(Tclin)
UniProt: P20815
LinkDB
Structure
PDB: 
6MJM 5VEU

Position
7q22.1
AA seq 502 aa
MDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKF
DTECYKKYGKMWGTYEGQLPVLAITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISL
AEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYS
MDVITGTSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLSIILFPFLTPVFEALNVSL
FPKDTINFLSKSVNRMKKSRLNDKQKHRLDFLQLMIDSQNSKETESHKALSDLELAAQSI
IFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPTYDAVVQMEYLDMVV
NETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFS
KKKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQG
LLQPEKPIVLKVDSRDGTLSGE
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggacctcatcccaaatttggcggtggaaacctggcttctcctggctgtcagcctggtg
ctcctctatctatatgggacccgtacacatggactttttaagagactgggaattccaggg
cccacacctctgcctttgttgggaaatgttttgtcctatcgtcagggtctctggaaattt
gacacagagtgctataaaaagtatggaaaaatgtggggaacgtatgaaggtcaactccct
gtgctggccatcacagatcccgacgtgatcagaacagtgctagtgaaagaatgttattct
gtcttcacaaatcgaaggtctttaggcccagtgggatttatgaaaagtgccatctcttta
gctgaggatgaagaatggaagagaatacggtcattgctgtctccaaccttcaccagcgga
aaactcaaggagatgttccccatcattgcccagtatggagatgtattggtgagaaacttg
aggcgggaagcagagaaaggcaagcctgtcaccttgaaagacatctttggggcctacagc
atggatgtgattactggcacatcatttggagtgaacatcgactctctcaacaatccacaa
gacccctttgtggagagcactaagaagttcctaaaatttggtttcttagatccattattt
ctctcaataatactctttccattccttaccccagtttttgaagcattaaatgtctctctg
tttccaaaagataccataaattttttaagtaaatctgtaaacagaatgaagaaaagtcgc
ctcaacgacaaacaaaagcaccgactagatttccttcagctgatgattgactcccagaat
tcgaaagaaactgagtcccacaaagctctgtctgatctggagctcgcagcccagtcaata
atcttcatttttgctggctatgaaaccaccagcagtgttctttccttcactttatatgaa
ctggccactcaccctgatgtccagcagaaactgcaaaaggagattgatgcagttttgccc
aataaggcaccacctacctatgatgccgtggtacagatggagtaccttgacatggtggtg
aatgaaacactcagattattcccagttgctattagacttgagaggacttgcaagaaagat
gttgaaatcaatggggtattcattcccaaagggtcaatggtggtgattccaacttatgct
cttcaccatgacccaaagtactggacagagcctgaggagttccgccctgaaaggttcagt
aagaagaaggacagcatagatccttacatatacacaccctttggaactggacccagaaac
tgcattggcatgaggtttgctctcatgaacatgaaacttgctctaatcagagtccttcag
aacttctccttcaaaccttgtaaagaaacacagatccccttgaaattagacacgcaagga
cttcttcaaccagaaaaacccattgttctaaaggtggattcaagagatggaaccctaagt
ggagaatga

DBGET integrated database retrieval system