KEGG   Homo sapiens (human): 100913187
Entry
100913187         CDS       T01001                                 

Gene name
APOBEC3A_B, A3A, APOBEC3A
Definition
(RefSeq) APOBEC3A and APOBEC3B deletion hybrid
  KO
K18750  C->U-editing enzyme APOBEC3 [EC:3.5.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100913187 (APOBEC3A_B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    100913187 (APOBEC3A_B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.-  
     100913187 (APOBEC3A_B)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100913187 (APOBEC3A_B)
SSDB
Motif
Pfam: NAD2 APOBEC2 NAD1 APOBEC_N APOBEC3 SNAD4 APOBEC_C APOBEC4_like APOBEC4 APOBEC1
Other DBs
NCBI-GeneID: 100913187
NCBI-ProteinID: NP_001180218
HGNC: 44196
UniProt: P31941 A0A0K0MJ49
LinkDB
Structure
PDB: 
5KEG 4XXO 5SWW 2M65

Position
22q13 alternate reference locus
AA seq 199 aa
MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAK
NLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHV
RLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLD
EHSQALSGRLRAILQNQGN
NT seq 600 nt   +upstreamnt  +downstreamnt
atggaagccagcccagcatccgggcccagacacttgatggatccacacatattcacttcc
aactttaacaatggcattggaaggcataagacctacctgtgctacgaagtggagcgcctg
gacaatggcacctcggtcaagatggaccagcacaggggctttctacacaaccaggctaag
aatcttctctgtggcttttacggccgccatgcggagctgcgcttcttggacctggttcct
tctttgcagttggacccggcccagatctacagggtcacttggttcatctcctggagcccc
tgcttctcctggggctgtgccggggaagtgcgtgcgttccttcaggagaacacacacgtg
agactgcgtatcttcgctgcccgcatctatgattacgaccccctatataaggaggcactg
caaatgctgcgggatgctggggcccaagtctccatcatgacctacgatgaatttaagcac
tgctgggacacctttgtggaccaccagggatgtcccttccagccctgggatggactagat
gagcacagccaagccctgagtgggaggctgcgggccattctccagaatcagggaaactga

KEGG   Homo sapiens (human): 140564
Entry
140564            CDS       T01001                                 

Gene name
APOBEC3D, A3D, A3DE, APOBEC3DE, APOBEC3E, ARP6
Definition
(RefSeq) apolipoprotein B mRNA editing enzyme catalytic subunit 3D
  KO
K18750  C->U-editing enzyme APOBEC3 [EC:3.5.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    140564 (APOBEC3D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    140564 (APOBEC3D)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.-  
     140564 (APOBEC3D)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     140564 (APOBEC3D)
SSDB
Motif
Pfam: NAD2 APOBEC2 NAD1 APOBEC_N SNAD4 APOBEC3 APOBEC_C APOBEC4_like APOBEC4 APOBEC1 dCMP_cyt_deam_1 Toxin-deaminase Hairy_orange
Other DBs
NCBI-GeneID: 140564
NCBI-ProteinID: NP_001350710
OMIM: 609900
HGNC: 17354
Ensembl: ENSG00000243811
Vega: OTTHUMG00000151084
LinkDB
Position
22q13.1
AA seq 202 aa
MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGPVL
PKRQSNHRQEVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFL
ARHSNVNLTIFTARLCYFWDTDYQEGLCSLSQEGASVKIMGYKDFVSCWKNFVYSDDEPF
KPWKGLQTNFRLLKRRLREILQ
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaatccacagatcagaaatccgatggagcggatgtatcgagacacattctacgacaac
tttgaaaacgaacccatcctctatggtcggagctacacttggctgtgctatgaagtgaaa
ataaagaggggccgctcaaatctcctttgggacacaggggtctttcgaggcccggtacta
cccaaacgtcagtcgaatcacaggcaggaggtggatcctgagacccattgtcatgcagaa
aggtgcttcctctcttggttctgtgacgacatactgtctcctaacacaaactacgaggtc
acctggtacacatcttggagcccttgcccagagtgtgcaggggaggtggccgagttcctg
gccaggcacagcaacgtgaatctcaccatcttcaccgcccgcctctgctacttctgggat
acagattaccaggaggggctctgcagcctgagtcaggaaggggcctccgtgaagatcatg
ggctacaaagattttgtatcttgttggaaaaactttgtgtacagtgatgatgagccattc
aagccttggaagggactacaaaccaactttcgacttctgaaaagaaggctacgggagatt
ctccagtga

KEGG   Homo sapiens (human): 164668
Entry
164668            CDS       T01001                                 

Gene name
APOBEC3H, A3H, ARP-10, ARP10
Definition
(RefSeq) apolipoprotein B mRNA editing enzyme catalytic subunit 3H
  KO
K18750  C->U-editing enzyme APOBEC3 [EC:3.5.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    164668 (APOBEC3H)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    164668 (APOBEC3H)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.-  
     164668 (APOBEC3H)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     164668 (APOBEC3H)
SSDB
Motif
Pfam: APOBEC3 NAD1 APOBEC2 NAD2 SNAD4 APOBEC_N APOBEC_C APOBEC4_like APOBEC4 APOBEC1 dCMP_cyt_deam_1 MafB19-deam
Other DBs
NCBI-GeneID: 164668
NCBI-ProteinID: NP_001159475
OMIM: 610976
HGNC: 24100
Ensembl: ENSG00000100298
Vega: OTTHUMG00000151082
Pharos: Q6NTF7(Tbio)
UniProt: Q6NTF7
LinkDB
Structure
PDB: 
6B0B 6BBO

Position
22q13.1
AA seq 200 aa
MALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICFI
NEIKSMGLDETQCYQVTCYLTWSPCSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQ
KGLRLLCGSQVPVEVMGFPEFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERI
KIPGVRAQGRYMDILCDAEV
NT seq 603 nt   +upstreamnt  +downstreamnt
atggctctgttaacagccgaaacattccgcttacagtttaacaacaagcgccgcctcaga
aggccttactacccgaggaaggccctcttgtgttaccagctgacgccgcagaatggctcc
acgcccacgagaggctactttgaaaacaagaaaaagtgccatgcagaaatttgctttatt
aacgagatcaagtccatgggactggacgaaacgcagtgctaccaagtcacctgttacctc
acgtggagcccctgctcctcctgtgcctgggagctggttgacttcatcaaggctcacgac
catctgaacctgggcatcttcgcctcccgcctgtactaccactggtgcaagccccagcag
aaggggctgcggcttctgtgtggatcccaggtcccggtggaggtcatgggcttcccagag
tttgctgactgctgggaaaactttgtggaccacgagaaaccgctttccttcaacccctat
aagatgttagaggagctagataaaaacagtcgagccataaagcgacggcttgagaggata
aagattccaggggtacgtgcgcagggtcgttacatggatatattgtgtgatgctgaggtc
tga

KEGG   Homo sapiens (human): 200315
Entry
200315            CDS       T01001                                 

Gene name
APOBEC3A, A3A, ARP3, PHRBN, bK150C2.1
Definition
(RefSeq) apolipoprotein B mRNA editing enzyme catalytic subunit 3A
  KO
K18750  C->U-editing enzyme APOBEC3 [EC:3.5.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    200315 (APOBEC3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    200315 (APOBEC3A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.-  
     200315 (APOBEC3A)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     200315 (APOBEC3A)
SSDB
Motif
Pfam: NAD2 APOBEC2 NAD1 APOBEC_N APOBEC3 SNAD4 APOBEC_C APOBEC4_like APOBEC4 APOBEC1
Other DBs
NCBI-GeneID: 200315
NCBI-ProteinID: NP_663745
OMIM: 607109
HGNC: 17343
Ensembl: ENSG00000128383
Vega: OTTHUMG00000151004
Pharos: P31941(Tbio)
UniProt: P31941 A0A0K0MJ49
LinkDB
Structure
PDB: 
5KEG 4XXO 5SWW 2M65

Position
22q13.1
AA seq 199 aa
MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAK
NLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHV
RLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLD
EHSQALSGRLRAILQNQGN
NT seq 600 nt   +upstreamnt  +downstreamnt
atggaagccagcccagcatccgggcccagacacttgatggatccacacatattcacttcc
aactttaacaatggcattggaaggcataagacctacctgtgctacgaagtggagcgcctg
gacaatggcacctcggtcaagatggaccagcacaggggctttctacacaaccaggctaag
aatcttctctgtggcttttacggccgccatgcggagctgcgcttcttggacctggttcct
tctttgcagttggacccggcccagatctacagggtcacttggttcatctcctggagcccc
tgcttctcctggggctgtgccggggaagtgcgtgcgttccttcaggagaacacacacgtg
agactgcgtatcttcgctgcccgcatctatgattacgaccccctatataaggaggcactg
caaatgctgcgggatgctggggcccaagtctccatcatgacctacgatgaatttaagcac
tgctgggacacctttgtggaccaccagggatgtcccttccagccctgggatggactagat
gagcacagccaagccctgagtgggaggctgcgggccattctccagaatcagggaaactga

KEGG   Homo sapiens (human): 200316
Entry
200316            CDS       T01001                                 

Gene name
APOBEC3F, A3F, ARP8, BK150C2.4.MRNA, KA6
Definition
(RefSeq) apolipoprotein B mRNA editing enzyme catalytic subunit 3F
  KO
K18750  C->U-editing enzyme APOBEC3 [EC:3.5.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    200316 (APOBEC3F)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    200316 (APOBEC3F)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.-  
     200316 (APOBEC3F)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     200316 (APOBEC3F)
SSDB
Motif
Pfam: NAD2 APOBEC2 NAD1 APOBEC_N SNAD4 APOBEC3 APOBEC_C APOBEC4_like APOBEC4 APOBEC1 AID dCMP_cyt_deam_1 Toxin-deaminase Hairy_orange SGNH
Other DBs
NCBI-GeneID: 200316
NCBI-ProteinID: NP_660341
OMIM: 608993
HGNC: 17356
Ensembl: ENSG00000128394
Vega: OTTHUMG00000151080
Pharos: Q8IUX4(Tbio)
UniProt: Q8IUX4
LinkDB
Structure
PDB: 

Position
22q13.1
AA seq 373 aa
MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVYS
QPEHHAEMCFLSWFCGNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLAEHPNVTLTISAA
RLYYYWERDYRRALCRLSQAGARVKIMDDEEFAYCWENFVYSEGQPFMPWYKFDDNYAFL
HRTLKEILRNPMEAMYPHIFYFHFKNLRKAYGRNESWLCFTMEVVKHHSPVSWKRGVFRN
QVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLT
IFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYN
FLFLDSKLQEILE
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgaagcctcacttcagaaacacagtggagcgaatgtatcgagacacattctcctacaac
ttttataatagacccatcctttctcgtcggaataccgtctggctgtgctacgaagtgaaa
acaaagggtccctcaaggccccgtttggacgcaaagatctttcgaggccaggtgtattcc
cagcctgagcaccacgcagaaatgtgcttcctctcttggttctgtggcaaccagctgcct
gcttacaagtgtttccagatcacctggtttgtatcctggaccccctgcccggactgtgtg
gcgaagctggccgaattcctggctgagcaccccaatgtcaccctgaccatctccgccgcc
cgcctctactactactgggaaagagattaccgaagggcgctctgcaggctgagtcaggca
ggggcccgcgtgaagattatggacgatgaagaatttgcatactgctgggaaaactttgtg
tacagtgaaggtcagccattcatgccttggtacaaattcgatgacaattatgcattcctg
caccgcacgctaaaggagattctcagaaacccgatggaggcaatgtatccacacatattc
tacttccactttaaaaacctacgcaaagcctatggtcggaacgaaagctggctgtgcttc
accatggaagttgtaaagcaccactcacctgtctcctggaagaggggcgtcttccgaaac
caggtggatcctgagacccattgtcatgcagaaaggtgcttcctctcttggttctgtgac
gacatactgtctcctaacacaaactacgaggtcacctggtacacatcttggagcccttgc
ccagagtgtgcaggggaggtggccgagttcctggccaggcacagcaacgtgaatctcacc
atcttcaccgcccgcctctactacttctgggatacagattaccaggaggggctccgcagc
ctgagtcaggaaggggcctccgtggagatcatgggctacaaagattttaaatattgttgg
gaaaactttgtgtacaatgatgatgagccattcaagccttggaaaggactaaaatacaac
tttctattcctggacagcaagctgcaggagattctcgagtga

KEGG   Homo sapiens (human): 27350
Entry
27350             CDS       T01001                                 

Gene name
APOBEC3C, A3C, APOBEC1L, ARDC2, ARDC4, ARP5, PBI, bK150C2.3
Definition
(RefSeq) apolipoprotein B mRNA editing enzyme catalytic subunit 3C
  KO
K18750  C->U-editing enzyme APOBEC3 [EC:3.5.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    27350 (APOBEC3C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    27350 (APOBEC3C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.-  
     27350 (APOBEC3C)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     27350 (APOBEC3C)
SSDB
Motif
Pfam: NAD2 APOBEC2 NAD1 APOBEC_N SNAD4 APOBEC3 APOBEC_C APOBEC4_like APOBEC4 APOBEC1 dCMP_cyt_deam_1 Toxin-deaminase
Other DBs
NCBI-GeneID: 27350
NCBI-ProteinID: NP_055323
OMIM: 607750
HGNC: 17353
Ensembl: ENSG00000244509
Vega: OTTHUMG00000151087
Pharos: Q9NRW3(Tbio)
UniProt: Q9NRW3
LinkDB
Structure
PDB: 
3VOW 3VM8

Position
22q13.1
AA seq 190 aa
MNPQIRNPMKAMYPGTFYFQFKNLWEANDRNETWLCFTVEGIKRRSVVSWKTGVFRNQVD
SETHCHAERCFLSWFCDDILSPNTKYQVTWYTSWSPCPDCAGEVAEFLARHSNVNLTIFT
ARLYYFQYPCYQEGLRSLSQEGVAVEIMDYEDFKYCWENFVYNDNEPFKPWKGLKTNFRL
LKRRLRESLQ
NT seq 573 nt   +upstreamnt  +downstreamnt
atgaatccacagatcagaaacccgatgaaggcaatgtatccaggcacattctacttccaa
tttaaaaacctatgggaagccaacgatcggaacgaaacttggctgtgcttcaccgtggaa
ggtataaagcgccgctcagttgtctcctggaagacgggcgtcttccgaaaccaggtggat
tctgagacccattgtcatgcagaaaggtgcttcctctcttggttctgcgacgacatactg
tctcctaacacaaagtaccaggtcacctggtacacatcttggagcccttgcccagactgt
gcaggggaggtggccgagttcctggccaggcacagcaacgtgaatctcaccatcttcacc
gcccgcctctactacttccagtatccatgttaccaggaggggctccgcagcctgagtcag
gaaggggtcgctgtggagatcatggactatgaagattttaaatattgttgggaaaacttt
gtgtacaatgataatgagccattcaagccttggaagggattaaaaaccaactttcgactt
ctgaaaagaaggctacgggagagtctccagtga

KEGG   Homo sapiens (human): 60489
Entry
60489             CDS       T01001                                 

Gene name
APOBEC3G, A3G, ARCD, ARP-9, ARP9, CEM-15, CEM15, MDS019, bK150C2.7, dJ494G10.1
Definition
(RefSeq) apolipoprotein B mRNA editing enzyme catalytic subunit 3G
  KO
K18750  C->U-editing enzyme APOBEC3 [EC:3.5.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    60489 (APOBEC3G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    60489 (APOBEC3G)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.-  
     60489 (APOBEC3G)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     60489 (APOBEC3G)
SSDB
Motif
Pfam: NAD2 APOBEC2 NAD1 APOBEC_N SNAD4 APOBEC3 APOBEC_C APOBEC4 APOBEC4_like APOBEC1 AID Toxin-deaminase Pox_A3L NODP
Other DBs
NCBI-GeneID: 60489
NCBI-ProteinID: NP_068594
OMIM: 607113
HGNC: 17357
Ensembl: ENSG00000239713
Vega: OTTHUMG00000151081
Pharos: Q9HC16(Tbio)
UniProt: Q9HC16
LinkDB
Structure
PDB: 

Position
22q13.1
AA seq 384 aa
MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPPLDAKIFRGQVYS
ELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKCTRDMATFLAEDPKVTLTIFV
ARLYYFWDPDYQEALRSLCQKRDGPRATMKIMNYDEFQHCWSKFVYSQRELFEPWNNLPK
YYILLHIMLGEILRHSMDPPTFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVLLNQRRG
FLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFIS
KNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQP
WDGLDEHSQDLSGRLRAILQNQEN
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgaagcctcacttcagaaacacagtggagcgaatgtatcgagacacattctcctacaac
ttttataatagacccatcctttctcgtcggaataccgtctggctgtgctacgaagtgaaa
acaaagggtccctcaaggccccctttggacgcaaagatctttcgaggccaggtgtattcc
gaacttaagtaccacccagagatgagattcttccactggttcagcaagtggaggaagctg
catcgtgaccaggagtatgaggtcacctggtacatatcctggagcccctgcacaaagtgt
acaagggatatggccacgttcctggccgaggacccgaaggttaccctgaccatctttgtt
gcccgcctctactacttctgggacccagattaccaggaggcgcttcgcagcctgtgtcag
aaaagagacggtccgcgtgccaccatgaagatcatgaattatgacgaatttcagcactgt
tggagcaagttcgtgtacagccaaagagagctatttgagccttggaataatctgcctaaa
tattatatattactgcacatcatgctgggggagattctcagacactcgatggatccaccc
acattcactttcaactttaacaatgaaccttgggtcagaggacggcatgagacttacctg
tgttatgaggtggagcgcatgcacaatgacacctgggtcctgctgaaccagcgcaggggc
tttctatgcaaccaggctccacataaacacggtttccttgaaggccgccatgcagagctg
tgcttcctggacgtgattcccttttggaagctggacctggaccaggactacagggttacc
tgcttcacctcctggagcccctgcttcagctgtgcccaggaaatggctaaattcatttca
aaaaacaaacacgtgagcctgtgcatcttcactgcccgcatctatgatgatcaaggaaga
tgtcaggaggggctgcgcaccctggccgaggctggggccaaaatttcaataatgacatac
agtgaatttaagcactgctgggacacctttgtggaccaccagggatgtcccttccagccc
tgggatggactagatgagcacagccaagacctgagtgggaggctgcgggccattctccag
aatcaggaaaactga

KEGG   Homo sapiens (human): 9582
Entry
9582              CDS       T01001                                 

Gene name
APOBEC3B, A3B, APOBEC1L, ARCD3, ARP4, DJ742C19.2, PHRBNL, bK150C2.2
Definition
(RefSeq) apolipoprotein B mRNA editing enzyme catalytic subunit 3B
  KO
K18750  C->U-editing enzyme APOBEC3 [EC:3.5.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    9582 (APOBEC3B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    9582 (APOBEC3B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.-  
     9582 (APOBEC3B)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     9582 (APOBEC3B)
SSDB
Motif
Pfam: NAD2 APOBEC2 NAD1 APOBEC_N SNAD4 APOBEC3 APOBEC_C APOBEC4_like APOBEC4 APOBEC1 dCMP_cyt_deam_1 SGNH Viral_Rep Toxin-deaminase
Other DBs
NCBI-GeneID: 9582
NCBI-ProteinID: NP_004891
OMIM: 607110
HGNC: 17352
Ensembl: ENSG00000179750
Vega: OTTHUMG00000151085
Pharos: Q9UH17(Tbio)
UniProt: Q9UH17
LinkDB
Structure
PDB: 

Position
22q13.1
AA seq 382 aa
MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGQVY
FKPQYHAEMCFLSWFCGNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISA
ARLYYYWERDYRRALCRLSQAGARVTIMDYEEFAYCWENFVYNEGQQFMPWYKFDENYAF
LHRTLKEILRYLMDPDTFTFNFNNDPLVLRRRQTYLCYEVERLDNGTWVLMDQHMGFLCN
EAKNLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQEN
THVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFEYCWDTFVYRQGCPFQPWD
GLEEHSQALSGRLRAILQNQGN
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgaatccacagatcagaaatccgatggagcggatgtatcgagacacattctacgacaac
tttgaaaacgaacccatcctctatggtcggagctacacttggctgtgctatgaagtgaaa
ataaagaggggccgctcaaatctcctttgggacacaggggtctttcgaggccaggtgtat
ttcaagcctcagtaccacgcagaaatgtgcttcctctcttggttctgtggcaaccagctg
cctgcttacaagtgtttccagatcacctggtttgtatcctggaccccctgcccggactgt
gtggcgaagctggccgaattcctgtctgagcaccccaatgtcaccctgaccatctctgcc
gcccgcctctactactactgggaaagagattaccgaagggcgctctgcaggctgagtcag
gcaggagcccgcgtgacgatcatggactatgaagaatttgcatactgctgggaaaacttt
gtgtacaatgaaggtcagcaattcatgccttggtacaaattcgatgaaaattatgcattc
ctgcaccgcacgctaaaggagattctcagatacctgatggatccagacacattcactttc
aactttaataatgaccctttggtccttcgacggcgccagacctacttgtgctatgaggtg
gagcgcctggacaatggcacctgggtcctgatggaccagcacatgggctttctatgcaac
gaggctaagaatcttctctgtggcttttacggccgccatgcggagctgcgcttcttggac
ctggttccttctttgcagttggacccggcccagatctacagggtcacttggttcatctcc
tggagcccctgcttctcctggggctgtgccggggaagtgcgtgcgttccttcaggagaac
acacacgtgagactgcgcatcttcgctgcccgcatctatgattacgaccccctatataag
gaggcgctgcaaatgctgcgggatgctggggcccaagtctccatcatgacctacgatgag
tttgagtactgctgggacacctttgtgtaccgccagggatgtcccttccagccctgggat
ggactagaggagcacagccaagccctgagtgggaggctgcgggccattctccagaatcag
ggaaactga

DBGET integrated database retrieval system