KEGG   Homo sapiens (human): 10092Help
Entry
10092             CDS       T01001                                 

Gene name
ARPC5, ARC16, dJ127C7.3, p16-Arc
Definition
(RefSeq) actin related protein 2/3 complex subunit 5
  KO
K05754  actin related protein 2/3 complex, subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    10092 (ARPC5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10092 (ARPC5)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    10092 (ARPC5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10092 (ARPC5)
   05132 Salmonella infection
    10092 (ARPC5)
   05131 Shigellosis
    10092 (ARPC5)
   05100 Bacterial invasion of epithelial cells
    10092 (ARPC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10092 (ARPC5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10092 (ARPC5)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    10092 (ARPC5)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     10092 (ARPC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P16-Arc UTP15_C Utp12
Motif
Other DBs
NCBI-GeneID: 10092
NCBI-ProteinID: NP_005708
OMIM: 604227
HGNC: 708
Ensembl: ENSG00000162704
Vega: OTTHUMG00000035326
Pharos: O15511(Tbio)
UniProt: O15511
LinkDB All DBs
Position
1q25.3
AA seq 151 aa AA seqDB search
MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALK
NPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDN
SSAMLLQWHEKALAAGGVGSIVRVLTARKTV
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaacacagtgtcgtcggcccgcttccggaaggtggacgtggatgaatatgac
gagaacaagttcgtggacgaagaagatgggggcgacggccaggccgggcccgacgagggc
gaggtggactcctgcctgcggcaaggaaacatgacagctgccctacaggcagctctgaag
aacccccctatcaacaccaagagtcaggcagtgaaggaccgggcaggcagcattgtcttg
aaggtgctcatctcttttaaagctaatgatatagaaaaggcagttcaatctctggacaag
aatggtgtggatctcctaatgaagtatatttataaaggatttgagagcccgtctgacaat
agcagtgctatgttactgcaatggcatgaaaaggcacttgctgctggaggagtagggtcc
attgttcgtgtcttgactgcaagaaaaactgtgtag

KEGG   Homo sapiens (human): 10093Help
Entry
10093             CDS       T01001                                 

Gene name
ARPC4, ARC20, P20-ARC
Definition
(RefSeq) actin related protein 2/3 complex subunit 4
  KO
K05755  actin related protein 2/3 complex, subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    10093 (ARPC4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10093 (ARPC4)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    10093 (ARPC4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10093 (ARPC4)
   05132 Salmonella infection
    10093 (ARPC4)
   05131 Shigellosis
    10093 (ARPC4)
   05100 Bacterial invasion of epithelial cells
    10093 (ARPC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10093 (ARPC4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10093 (ARPC4)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    10093 (ARPC4)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     10093 (ARPC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARPC4 Sm_like
Motif
Other DBs
NCBI-GeneID: 10093
NCBI-ProteinID: NP_005709
OMIM: 604226
HGNC: 707
Ensembl: ENSG00000241553
Vega: OTTHUMG00000133768
Pharos: P59998(Tbio)
UniProt: P59998
LinkDB All DBs
Position
3p25.3
AA seq 168 aa AA seqDB search
MTATLRPYLSAVRATLQAALCLENFSSQVVERHNKPEVEVRSSKELLLQPVTISRNEKEK
VLIEGSINSVRVSIAVKQADEIEKILCHKFMRFMMMRAENFFILRRKPVEGYDISFLITN
FHTEQMYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgactgccactctccgcccctacctgagtgccgtgcgggccacattgcaggctgccctc
tgcctggagaacttctcctcccaggttgtggaacgacacaacaagccggaagtggaagtc
aggagtagcaaagagctcctgttacaacctgtgaccatcagcaggaatgagaaggaaaag
gttctgattgagggctccatcaactctgtccgggtcagcattgctgtgaaacaggctgat
gagatcgagaagattttgtgccacaagttcatgcgcttcatgatgatgcgagcagagaac
ttctttatccttcgaaggaagcctgtggaggggtatgatatcagctttctgatcaccaac
ttccacacagagcagatgtacaaacacaagttggtggactttgtgatccacttcatggag
gagattgacaaggagatcagtgagatgaagctgtcagtcaatgcccgtgcccgcattgtg
gctgaagagttccttaagaatttttaa

KEGG   Homo sapiens (human): 10094Help
Entry
10094             CDS       T01001                                 

Gene name
ARPC3, ARC21, p21-Arc
Definition
(RefSeq) actin related protein 2/3 complex subunit 3
  KO
K05756  actin related protein 2/3 complex, subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    10094 (ARPC3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10094 (ARPC3)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    10094 (ARPC3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10094 (ARPC3)
   05132 Salmonella infection
    10094 (ARPC3)
   05131 Shigellosis
    10094 (ARPC3)
   05100 Bacterial invasion of epithelial cells
    10094 (ARPC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10094 (ARPC3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10094 (ARPC3)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    10094 (ARPC3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     10094 (ARPC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P21-Arc
Motif
Other DBs
NCBI-GeneID: 10094
NCBI-ProteinID: NP_001265485
OMIM: 604225
HGNC: 706
Ensembl: ENSG00000111229
Vega: OTTHUMG00000134333
Pharos: O15145(Tbio)
UniProt: O15145
LinkDB All DBs
Position
12q24.11
AA seq 178 aa AA seqDB search
MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEI
KNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKP
ANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgccggcttaccactcttctctcatggatcctgataccaaactcatcggaaacatggca
ctgttgcctatcagaagtcaattcaaaggacctgcccccagagagacaaaagatacagat
attgtggatgaagccatctattacttcaaggccaatgtcttcttcaaaaactatgaaatt
aagaatgaagctgataggaccttgatatatataactctctacatttctgaatgtctgaag
aaactgcaaaagtgcaattccaaaagccaaggtgagaaagaaatgtatacgctgggaatc
actaattttcccattcctggagagcctggttttccacttaacgcaatttatgccaaacct
gcaaacaaacaggaagatgaagtgatgagagcctatttacaacagctaaggcaagagact
ggactgagactttgtgagaaagttttcgaccctcagaatgataaacccagcaagtggtgg
acttgctttgtgaagagacagttcatgaacaagagtctttcaggacctggacagtga

KEGG   Homo sapiens (human): 10095Help
Entry
10095             CDS       T01001                                 

Gene name
ARPC1B, ARC41, PLTEID, p40-ARC, p41-ARC
Definition
(RefSeq) actin related protein 2/3 complex subunit 1B
  KO
K05757  actin related protein 2/3 complex, subunit 1A/1B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    10095 (ARPC1B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10095 (ARPC1B)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    10095 (ARPC1B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10095 (ARPC1B)
   05132 Salmonella infection
    10095 (ARPC1B)
   05131 Shigellosis
    10095 (ARPC1B)
   05100 Bacterial invasion of epithelial cells
    10095 (ARPC1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10095 (ARPC1B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10095 (ARPC1B)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    10095 (ARPC1B)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     10095 (ARPC1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A
Motif
Other DBs
NCBI-GeneID: 10095
NCBI-ProteinID: NP_005711
OMIM: 604223
HGNC: 704
Ensembl: ENSG00000130429
Vega: OTTHUMG00000154552
Pharos: O15143(Tbio)
UniProt: O15143 A4D275
LinkDB All DBs
Position
7q22.1
AA seq 372 aa AA seqDB search
MAYHSFLVEPISCHAWNKDRTQIAICPNNHEVHIYEKSGAKWTKVHELKEHNGQVTGIDW
APESNRIVTCGTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNENKFAVGSGSRVI
SICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERP
APTPWGSKMPFGELMFESSSSCGWVHGVCFSASGSRVAWVSHDSTVCLADADKKMAVATL
ASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARE
RFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVK
SLESALKDLKIK
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcctaccacagcttcctggtggagcccatcagctgccacgcctggaacaaggaccgc
acccagattgccatctgccccaacaaccatgaggtgcatatctatgaaaagagcggtgcc
aaatggaccaaggtgcacgagctcaaggagcacaacgggcaggtgacaggcatcgactgg
gcccccgagagtaaccgtattgtgacctgcggcacagaccgcaacgcctacgtgtggacg
ctgaagggccgcacatggaagcccacgctggtcatcctgcggatcaaccgggctgcccgc
tgcgtgcgctgggcccccaacgagaacaagtttgctgtgggcagcggctctcgtgtgatc
tccatctgttatttcgagcaggagaatgactggtgggtttgcaagcacatcaagaagccc
atccgctccaccgtcctcagcctggactggcaccccaacaatgtgctgctggctgccggc
tcctgtgacttcaagtgtcggatcttttcagcctacatcaaggaggtggaggaacggccg
gcacccaccccgtggggctccaagatgccctttggggaactgatgttcgaatccagcagt
agctgcggctgggtacatggcgtctgtttctcagccagcgggagccgcgtggcctgggta
agccacgacagcaccgtctgcctggctgatgccgacaagaagatggccgtcgcgactctg
gcctctgaaacactaccactgctggcgctgaccttcatcacagacaacagcctggtggca
gcgggccacgactgcttcccggtgctgttcacctatgacgccgccgcggggatgctgagc
ttcggcgggcggctggacgttcctaagcagagctcgcagcgtggcttgacggcccgcgag
cgcttccagaacctggacaagaaggcgagctccgagggtggcacggctgcgggcgcgggc
ctagactcgctgcacaagaacagcgtcagccagatctcggtgctcagcggcggcaaggcc
aagtgctcgcagttctgcaccactggcatggatggcggcatgagtatctgggatgtgaag
agcttggagtcagccttgaaggacctcaagatcaaatga

KEGG   Homo sapiens (human): 10109Help
Entry
10109             CDS       T01001                                 

Gene name
ARPC2, ARC34, PNAS-139, PRO2446, p34-Arc
Definition
(RefSeq) actin related protein 2/3 complex subunit 2
  KO
K05758  actin related protein 2/3 complex, subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    10109 (ARPC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10109 (ARPC2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    10109 (ARPC2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10109 (ARPC2)
   05132 Salmonella infection
    10109 (ARPC2)
   05131 Shigellosis
    10109 (ARPC2)
   05100 Bacterial invasion of epithelial cells
    10109 (ARPC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10109 (ARPC2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10109 (ARPC2)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    10109 (ARPC2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     10109 (ARPC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P34-Arc ARPC4
Motif
Other DBs
NCBI-GeneID: 10109
NCBI-ProteinID: NP_005722
OMIM: 604224
HGNC: 705
Ensembl: ENSG00000163466
Vega: OTTHUMG00000133618
Pharos: O15144(Tbio)
UniProt: O15144 Q53R19
LinkDB All DBs
Position
2q35
AA seq 300 aa AA seqDB search
MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSIS
LKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNC
FASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKV
FMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNT
INLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgctggaggtgaacaaccgcatcatcgaggagacgctcgcgctcaagttcgag
aacgcggccgccggaaacaaaccggaagcagtagaagtaacatttgcagatttcgatggg
gtcctctatcatatttcaaatcctaatggagacaaaacaaaagtgatggtcagtatttct
ttgaaattctacaaggaacttcaggcacatggtgctgatgagttattaaagagggtgtac
gggagtttcttggtaaatccagaatcaggatacaatgtctctttgctatatgaccttgaa
aatcttccggcatccaaggattccattgtgcatcaagctggcatgttgaagcgaaattgt
tttgcctctgtctttgaaaaatacttccaattccaagaagagggcaaggaaggagagaac
agggcagttatccattatagggatgatgagaccatgtatgttgagtctaaaaaggacaga
gtcacagtagtcttcagcacagtgtttaaggatgacgacgatgtggtcattggaaaggtg
ttcatgcaggagttcaaagaaggacgcagagccagccacacagccccacaggtcctcttt
agccacagggaacctcctctggagctgaaagacacagacgccgctgtgggtgacaacatt
ggctacattacctttgtgctgttccctcgtcacaccaatgccagtgctcgagacaacacc
atcaacctgatccacacgttccgggactacctgcactaccacatcaagtgctctaaggcc
tatattcacacacgtatgcgggcgaaaacgtctgacttcctcaaggtgctgaaccgcgca
cgcccagatgccgagaaaaaagaaatgaaaacaatcacggggaagacgttttcatcccgc
taa

KEGG   Homo sapiens (human): 10552Help
Entry
10552             CDS       T01001                                 

Gene name
ARPC1A, Arc40, HEL-68, HEL-S-307, SOP2Hs, SOP2L
Definition
(RefSeq) actin related protein 2/3 complex subunit 1A
  KO
K05757  actin related protein 2/3 complex, subunit 1A/1B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    10552 (ARPC1A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10552 (ARPC1A)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    10552 (ARPC1A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10552 (ARPC1A)
   05132 Salmonella infection
    10552 (ARPC1A)
   05131 Shigellosis
    10552 (ARPC1A)
   05100 Bacterial invasion of epithelial cells
    10552 (ARPC1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10552 (ARPC1A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10552 (ARPC1A)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    10552 (ARPC1A)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     10552 (ARPC1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 LytB_WW
Motif
Other DBs
NCBI-GeneID: 10552
NCBI-ProteinID: NP_006400
OMIM: 604220
HGNC: 703
Ensembl: ENSG00000241685
Vega: OTTHUMG00000154553
Pharos: Q92747(Tbio)
UniProt: Q92747 V9HVZ6
LinkDB All DBs
Position
7q22.1
AA seq 370 aa AA seqDB search
MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQWVKAHELKEHNGHITGIDW
APKSDRIVTCGADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLI
SVCYFESENDWWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKP
ASTPWGSKMPFGQLMSEFGGSGTGGWVHGVSFSASGSRLAWVSHDSTVSVADASKSVQVS
TLKTEFLPLLSVSFVSENSVVAAGHDCCPMLFNYDDRGCLTFVSKLDIPKQSIQRNMSAM
ERFRNMDKRATTEDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTGIDGAMTIWDFKTL
ESSIQGLRIM
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgcatcagtttttactagagccaatcacctgtcatgcctggaacagggatcgt
actcagattgccctcagtcccaataatcacgaagtgcacatctataagaagaacgggagc
cagtgggtgaaagctcatgaactcaaggagcacaacggacacatcacaggtattgactgg
gctcccaagagcgaccgcattgtcacttgtggggcagaccgcaatgcctatgtctggagt
cagaaagatggtgtttggaagccaaccctggtgatcctgagaattaatcgcgcagctact
tttgtgaagtggtcccccctagagaacaaatttgctgtgggaagtggagcacgactcatt
tctgtttgttactttgagtctgaaaatgactggtgggtgagcaagcacattaaaaagccg
attcgctccacagtcctcagcttggattggcatcccaacaacgttttgctggcagcagga
tcatgtgacttcaaatgcagagtgttttctgcctacattaaagaagtggatgaaaagcca
gccagcacgccctggggcagcaagatgccttttgggcagctgatgtcagagtttggtggc
agtggcactggtggctgggtccacggggtaagcttctctgccagtgggagccgcctggcc
tgggtcagccacgacagcaccgtgtctgttgctgatgcctcaaaaagtgtgcaggtctcg
actctgaagacagagttcctgccgctcctaagtgtgtcatttgtctcagagaacagcgtc
gtggctgctggccatgactgctgcccaatgctctttaactacgatgaccgcggctgcctg
accttcgtctccaagttagatattccaaaacagagcatccaacgcaacatgtctgccatg
gaacgcttccgcaacatggacaagagagccacaactgaggaccgcaacacggccttggag
acgctgcaccagaatagcatcactcaagtctctatttatgaggtggacaagcaagattgt
cgcaaattttgcactactggcatcgatggagccatgacaatttgggatttcaagaccctc
gagtcttccatccagggcctccggataatgtga

KEGG   Homo sapiens (human): 81873Help
Entry
81873             CDS       T01001                                 

Gene name
ARPC5L, ARC16-2
Definition
(RefSeq) actin related protein 2/3 complex subunit 5 like
  KO
K05754  actin related protein 2/3 complex, subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    81873 (ARPC5L)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    81873 (ARPC5L)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    81873 (ARPC5L)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    81873 (ARPC5L)
   05132 Salmonella infection
    81873 (ARPC5L)
   05131 Shigellosis
    81873 (ARPC5L)
   05100 Bacterial invasion of epithelial cells
    81873 (ARPC5L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    81873 (ARPC5L)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    81873 (ARPC5L)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    81873 (ARPC5L)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     81873 (ARPC5L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P16-Arc Utp12 UTP15_C
Motif
Other DBs
NCBI-GeneID: 81873
NCBI-ProteinID: NP_112240
HGNC: 23366
Ensembl: ENSG00000136950
Vega: OTTHUMG00000020660
Pharos: Q9BPX5(Tdark)
UniProt: Q9BPX5 A0A024R897 B3KPC7
LinkDB All DBs
Position
9q33.3
AA seq 153 aa AA seqDB search
MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAA
LRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPT
ENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggcccggaacacgctgtcctcgcgcttccgccgggtggacatcgacgaatttgacgag
aacaaatttgtggacgagcaggaggaggcggcggcggcggcggcggagccaggcccggac
ccgagcgaggtggacgggctcctgcggcaaggggacatgcttcgggcattccatgcagcc
ttgcggaactctcccgtcaacaccaagaatcaagctgtgaaggagcgagcccagggcgtg
gtgctgaaagtgctcacaaacttcaagagcagtgagattgagcaggctgtgcagtcactg
gacagaaacggcgttgacttgttaatgaagtacatttataaaggctttgagaagcccaca
gaaaatagcagcgcagtgttactccagtggcacgaaaaggccttagcagtaggaggacta
ggctccattataagagttcttacagcaagaaagactgtttaa

DBGET integrated database retrieval system