KEGG   Homo sapiens (human): 10110Help
Entry
10110             CDS       T01001                                 

Gene name
SGK2, H-SGK2, dJ138B7.2
Definition
(RefSeq) serum/glucocorticoid regulated kinase 2
  KO
K13303  serum/glucocorticoid-regulated kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    10110 (SGK2)
   04151 PI3K-Akt signaling pathway
    10110 (SGK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    10110 (SGK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     10110 (SGK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   10110 (SGK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_C Kdo
Motif
Other DBs
NCBI-GeneID: 10110
NCBI-ProteinID: NP_057360
OMIM: 607589
HGNC: 13900
Ensembl: ENSG00000101049
Vega: OTTHUMG00000033054
Pharos: Q9HBY8(Tbio)
UniProt: Q9HBY8
LinkDB All DBs
Position
20q13.12
AA seq 427 aa AA seqDB search
MQGLLTSGRKPSGGGRCTGRGGWRGQWCLKPWMGGADPPTPTLSCLLLPVPPELPDHCYR
MNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAF
YAVKVLQKKSILKKKEQSHIMAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGE
LFFHLQRERRFLEPRARFYAAEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGL
CKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVS
QMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHVFFSPINWDDL
YHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPE
DDDILDC
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggttgcttacctcgggtaggaaaccctcaggcggtggcaggtgcacaggtagg
ggaggatggagagggcagtggtgcctgaagccctggatgggcggagctgaccccccaaca
ccaactctctcatgcctgctcctccctgtccccccagagctgcctgatcattgctacaga
atgaactctagcccagctgggaccccaagtccacagccctccagggccaatgggaacatc
aacctggggccttcagccaacccaaatgcccagcccacggacttcgacttcctcaaagtc
atcggcaaagggaactacgggaaggtcctactggccaagcgcaagtctgatggggcgttc
tatgcagtgaaggtactacagaaaaagtccatcttaaagaagaaagagcagagccacatc
atggcagagcgcagtgtgcttctgaagaacgtgcggcaccccttcctcgtgggcctgcgc
tactccttccagacacctgagaagctctacttcgtgctcgactatgtcaacgggggagag
ctcttcttccacctgcagcgggagcgccggttcctggagccccgggccaggttctacgct
gctgaggtggccagcgccattggctacctgcactccctcaacatcatttacagggatctg
aaaccagagaacattctcttggactgccagggacacgtggtgctgacggattttggcctc
tgcaaggaaggtgtagagcctgaagacaccacatccacattctgtggtacccctgagtac
ttggcacctgaagtgcttcggaaagagccttatgatcgagcagtggactggtggtgcttg
ggggcagtcctctacgagatgctccatggcctgccgcccttctacagccaagatgtatcc
cagatgtatgagaacattctgcaccagccgctacagatccccggaggccggacagtggcc
gcctgtgacctcctgcaaagccttctccacaaggaccagaggcagcggctgggctccaaa
gcagactttcttgagattaagaaccatgtattcttcagccccataaactgggatgacctg
taccacaagaggctaactccacccttcaacccaaatgtgacaggacctgctgacttgaag
cattttgacccagagttcacccaggaagctgtgtccaagtccattggctgtacccctgac
actgtggccagcagctctggggcctcaagtgcattcctgggattttcttatgcgccagag
gatgatgacatcttggattgctag

DBGET integrated database retrieval system