KEGG   Homo sapiens (human): 10120
Entry
10120             CDS       T01001                                 

Gene name
ACTR1B, ARP1B, CTRN2, PC3
Definition
(RefSeq) actin related protein 1B
  KO
K16575  centractin
Organism
hsa  Homo sapiens (human)
Pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
N01295  Rab7-regulated microtubule minus-end directed transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    10120 (ACTR1B)
   05016 Huntington disease
    10120 (ACTR1B)
   05022 Pathways of neurodegeneration - multiple diseases
    10120 (ACTR1B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    10120 (ACTR1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10120 (ACTR1B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10120 (ACTR1B)
   04147 Exosome [BR:hsa04147]
    10120 (ACTR1B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     10120 (ACTR1B)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actin-related proteins
     10120 (ACTR1B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   10120 (ACTR1B)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 10120
NCBI-ProteinID: NP_005726
OMIM: 605144
HGNC: 168
Ensembl: ENSG00000115073
Vega: OTTHUMG00000130549
Pharos: P42025(Tdark)
UniProt: P42025
LinkDB
Position
2q11.2
AA seq 376 aa
MESYDIIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGP
KAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKN
REKAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSI
MRVDIAGRDVSRYLRLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDEALETEKVQ
YTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHKSDMDLRRTLFANIVL
SGGSTLFKGFGDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILASLDTFKKMWVSK
KEYEEDGSRAIHRKTF
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggagtcctacgacatcatcgccaaccagcctgtggtcatcgacaacggttcgggggtg
attaaagctggctttgcaggagaccagattcccaaatactgtttcccaaactatgtcggg
cggccgaagcacatgcgggtgatggctggagccctggagggggacctcttcatcggacca
aaagcagaggagcaccgggggctgctgaccatccgctaccccatggagcacggcgtggtg
cgagactggaacgacatggaacgcatctggcagtacgtctactccaaggatcagctgcag
accttctcggaggagcatcctgtgctcctcacggaggccccgctcaacccgagtaagaac
cgggagaaggcggcagaggtgttctttgagaccttcaacgtgccggccctgttcatctcc
atgcaggctgtgctcagtctgtacgcaacaggacgcacgacaggagtggttctagactca
ggggacggggtcactcatgctgtgcccatctatgagggctttgccatgcctcactccatc
atgcgggtggacattgccggccgcgacgtctcccgctacctccgactcctgctgcgcaag
gaaggggttgacttccatacctcggctgagtttgaggttgtccggacaatcaaagagcga
gcgtgctacctgtccatcaacccacagaaggatgaggctctggagacggagaaggtgcag
tacacgttgccagacggcagcacgcttgatgtggggcctgcacgattccgggcccccgag
ctgctgttccagccggaccttgtcggggatgagagtgaggggctccatgaggtggtggcc
ttcgccatacacaagtccgacatggacctgcgccggacgctgttcgccaacatcgtgctc
tcaggtggctcaacgcttttcaaaggcttcggagaccgattactcagtgaagtgaagaag
cttgccccaaaggatatcaaaatcaagatctcagccccgcaggaacggctgtactccaca
tggattggcggctccatcctggcctcgctggacacttttaagaagatgtgggtgtccaaa
aaggagtatgaagaggatggctcccgtgctattcatcgcaaaactttctag

KEGG   Homo sapiens (human): 10121
Entry
10121             CDS       T01001                                 

Gene name
ACTR1A, ARP1, Arp1A, CTRN1
Definition
(RefSeq) actin related protein 1A
  KO
K16575  centractin
Organism
hsa  Homo sapiens (human)
Pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
N01295  Rab7-regulated microtubule minus-end directed transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    10121 (ACTR1A)
   05016 Huntington disease
    10121 (ACTR1A)
   05022 Pathways of neurodegeneration - multiple diseases
    10121 (ACTR1A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    10121 (ACTR1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10121 (ACTR1A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10121 (ACTR1A)
   04147 Exosome [BR:hsa04147]
    10121 (ACTR1A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     10121 (ACTR1A)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actin-related proteins
     10121 (ACTR1A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   10121 (ACTR1A)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 10121
NCBI-ProteinID: NP_005727
OMIM: 605143
HGNC: 167
Ensembl: ENSG00000138107
Vega: OTTHUMG00000018956
Pharos: P61163(Tbio)
UniProt: P61163 A0A384NQ21
LinkDB
Position
10q24.32
AA seq 376 aa
MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGP
KAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKN
RERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSI
MRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQ
YYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVL
SGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSK
KEYEEDGARSIHRKTF
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggagtcctacgatgtgatcgccaaccagcctgtcgtgatcgacaacggatccggtgtg
attaaagctggttttgctggtgatcagatccccaaatactgctttccaaactatgtgggc
cgacccaagcacgttcgtgtcatggcaggagcccttgaaggcgacatcttcattggcccc
aaagctgaggagcaccgagggctgctttcaatccgctatcccatggagcatggcatcgtc
aaggattggaacgacatggaacgcatttggcaatatgtctattctaaggaccagctgcag
actttctcagaggagcatcctgtgctcctgactgaggcgcctttaaacccacgaaaaaac
cgggaacgagctgccgaagttttcttcgagaccttcaatgtgcccgctcttttcatctcc
atgcaagctgtactcagcctttacgctacaggcaggaccacaggggtggtgctggattct
ggggatggagtcacccatgctgtgcccatctatgagggctttgccatgccccactccatc
atgcgcatcgacatcgcgggccgggacgtctctcgcttcctgcgcctctacctgcgtaag
gagggctacgacttccactcatcctctgagtttgagattgtcaaggccataaaagaaaga
gcctgttacctatccataaacccccaaaaggatgagacgctagagacagagaaagctcag
tactacctgcctgatggcagcaccattgagattggtccttcccgattccgggcccctgag
ttgctcttcaggccagatttgattggagaggagagtgaaggcatccacgaggtcctggtg
ttcgccattcagaagtcagacatggacctgcggcgcacgcttttctctaacattgtcctc
tcaggaggctctaccctgttcaaaggttttggtgacaggctcctgagtgaagtgaagaaa
ctagctccaaaagatgtgaagatcaggatatctgcacctcaggagagactgtattccacg
tggattgggggctccatccttgcctccctggacacctttaagaagatgtgggtctccaaa
aaggaatatgaggaagacggtgcccgatccatccacagaaaaaccttctaa

KEGG   Homo sapiens (human): 10540
Entry
10540             CDS       T01001                                 

Gene name
DCTN2, DCTN50, DYNAMITIN, HEL-S-77, RBP50
Definition
(RefSeq) dynactin subunit 2
  KO
K10424  dynactin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04962  Vasopressin-regulated water reabsorption
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
N01295  Rab7-regulated microtubule minus-end directed transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    10540 (DCTN2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    10540 (DCTN2)
   05016 Huntington disease
    10540 (DCTN2)
   05022 Pathways of neurodegeneration - multiple diseases
    10540 (DCTN2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    10540 (DCTN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10540 (DCTN2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10540 (DCTN2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     10540 (DCTN2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     10540 (DCTN2)
SSDB
Motif
Pfam: Dynamitin ALIX_LYPXL_bnd PI_PP_I Fam20C ZapB PRD
Other DBs
NCBI-GeneID: 10540
NCBI-ProteinID: NP_001248342
OMIM: 607376
HGNC: 2712
Ensembl: ENSG00000175203
Vega: OTTHUMG00000170124
Pharos: Q13561(Tbio)
UniProt: Q13561 A0A384MDU9
LinkDB
Position
12q13.3
AA seq 401 aa
MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAEELTSTSVEHIIVNPNAAYDKFKDK
RVGTKGLDFSDRIGKTKRTGYESGEYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVEKI
KTTVKESATEEKLTPVLLAKQLAALKQQLVASHLEKLLGPDAAINLTDPDGALAKRLLLQ
LEATKNSKGGSGGKTTGTPPDSSLVTYELHSRPEQDKFSQAAKVAELEKRLTELETAVRC
DQDAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVEARLQSVLGKVNEIAKHKASV
EDADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMI
ANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKLGK
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggcggaccctaaatacgccgaccttcccggcattgccaggaatgagccagatgtttat
gaaactagcgacctacctgaggatgatcaagcggagttcgatgcggaggagctgacaagc
acaagtgtggaacacatcattgtcaatcctaatgctgcctatgacaagttcaaggacaag
agagtggggacaaagggacttgatttctcagatcgtattggaaaaaccaagaggacagga
tatgaatctggagaatatgagatgcttggagagggtctgggagtgaaggagacaccccag
caaaagtaccagcgcctactgcatgaggtccaagagctgacaactgaagttgaaaaaatc
aagacgacagtgaaggagtcagccacagaggagaagctgacccctgtgttgctggctaaa
cagctggcagccctgaagcagcagctggttgcttcccacctggagaagctgctgggacca
gatgctgcaatcaaccttaccgaccccgatggcgccctggctaagcgcctactactgcag
ctggaagcaacaaagaacagcaaagggggatcagggggaaaaaccactgggaccccccca
gatagcagccttgtcacttatgaactacattctcggcctgagcaggacaagttctctcaa
gctgccaaagtcgcagaacttgaaaagcgcctgacagagctggagacagctgtacgttgt
gatcaggatgctcagaatcccctttctgcaggtctacagggagcctgtctcatggagact
gtagagctgttgcaagcaaaggtgagcgccctagaccttgcagttttggatcaagtggag
gctcggctacagagtgtcctgggaaaggtgaacgagattgccaagcataaagcctctgta
gaagatgcagatacacaaagcaaggtgcaccagctatatgaaactatacagcgctggagc
cccattgcctccaccctccctgagctggtgcagagacttgtcaccatcaagcagctgcac
gagcaagccatgcagtttggtcagctcctgacacacttggataccacccagcagatgatt
gctaattccttgaaggacaataccaccctcttgacccaggtgcagacaaccatgcgtgaa
aacctggccacagttgaggggaactttgccagcattgatgaacggatgaagaagctggga
aagtga

KEGG   Homo sapiens (human): 10671
Entry
10671             CDS       T01001                                 

Gene name
DCTN6, WS-3, WS3, p27
Definition
(RefSeq) dynactin subunit 6
  KO
K10428  dynactin 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04962  Vasopressin-regulated water reabsorption
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
N01295  Rab7-regulated microtubule minus-end directed transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    10671 (DCTN6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    10671 (DCTN6)
   05016 Huntington disease
    10671 (DCTN6)
   05022 Pathways of neurodegeneration - multiple diseases
    10671 (DCTN6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    10671 (DCTN6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10671 (DCTN6)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10671 (DCTN6)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     10671 (DCTN6)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     10671 (DCTN6)
SSDB
Motif
Pfam: Hexapep
Other DBs
NCBI-GeneID: 10671
NCBI-ProteinID: NP_006562
OMIM: 612963
HGNC: 16964
Ensembl: ENSG00000104671
Vega: OTTHUMG00000163828
Pharos: O00399(Tdark)
UniProt: O00399
LinkDB
Structure
PDB: 
3TV0

Position
8p12
AA seq 190 aa
MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQA
LIINAYPDNITPDTEDPEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILT
SGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKT
MKGSSTPVKN
NT seq 573 nt   +upstreamnt  +downstreamnt
atggcggagaagactcaaaagagtgtgaagattgctcctggagcagttgtatgtgtagaa
agtgaaatcagaggagatgtaactatcggacctcggacagtgatccaccctaaagcaaga
attattgcggaagccgggccaatagtgattggcgaagggaacctaatagaagaacaggcc
cttatcataaatgcttacccagataatatcactcctgacactgaagatccagaaccaaaa
cctatgatcattggcaccaataatgtgtttgaagttggctgttattcccaagccatgaag
atgggagataataatgtcattgaatcaaaagcatatgtaggcagaaatgtaatattgaca
agtggctgcatcattggggcttgttgcaacctaaatacatttgaagtcatccctgagaat
acggtgatctatggtgcagactgccttcgtcgggtgcagactgagcgaccgcagccccag
acactacagctggatttcttgatgaaaatcttgccaaattaccaccacctaaagaagact
atgaaaggaagctcaactccagtaaagaactaa

KEGG   Homo sapiens (human): 11258
Entry
11258             CDS       T01001                                 

Gene name
DCTN3, DCTN-22, DCTN22
Definition
(RefSeq) dynactin subunit 3
  KO
K10425  dynactin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
N01295  Rab7-regulated microtubule minus-end directed transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    11258 (DCTN3)
   05016 Huntington disease
    11258 (DCTN3)
   05022 Pathways of neurodegeneration - multiple diseases
    11258 (DCTN3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    11258 (DCTN3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    11258 (DCTN3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    11258 (DCTN3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     11258 (DCTN3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     11258 (DCTN3)
SSDB
Motif
Pfam: Dynactin_p22 DUF4011 Spidroin_MaSp DivIC Tox-HNH-HHH
Other DBs
NCBI-GeneID: 11258
NCBI-ProteinID: NP_009165
OMIM: 607387
HGNC: 2713
Ensembl: ENSG00000137100
Vega: OTTHUMG00000019830
Pharos: O75935(Tdark)
UniProt: O75935
LinkDB
Position
9p13.3
AA seq 186 aa
MAGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKK
IEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVP
EHAARLQRLAQIHIQQQDQCVEITEESKALLEEYNKTTMLLSKQFVQWDELLCQLEAATQ
VKPAEE
NT seq 561 nt   +upstreamnt  +downstreamnt
atggcgggtctgactgacttgcagcggctacaggcccgagtggaagagctggagcgctgg
gtgtacgggccgggcggggcgcgcggctcacggaaggtggctgacggcctggtcaaggtg
caggtggctttggggaacatttccagcaagagggagagggtgaagattctctacaaaaag
attgaagatctgatcaagtacctggatcctgagtacatcgaccgcattgccatacctgat
gcctctaagctgcaattcatcctagcagaggagcagtttatcctttcccaggttgcactc
ctggagcaggtgaatgccttggtgcccatgctggacagtgctcacatcaaagccgttcct
gagcatgctgcccgcctgcagcgcttggcccagatccacattcagcagcaggaccagtgt
gtggaaatcactgaggagtccaaggctctcctggaggaatacaacaagactacaatgctt
ctctccaagcaattcgtgcagtgggatgagctactttgccagctagaggccgccacgcaa
gtgaagccagcagaggagtga

KEGG   Homo sapiens (human): 1639
Entry
1639              CDS       T01001                                 

Gene name
DCTN1, DAP-150, DP-150, P135
Definition
(RefSeq) dynactin subunit 1
  KO
K04648  dynactin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04962  Vasopressin-regulated water reabsorption
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01158  Mutation-caused aberrant DCTN1 to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
N01295  Rab7-regulated microtubule minus-end directed transport
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
H00856  Distal hereditary motor neuropathies
H00879  Perry syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    1639 (DCTN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    1639 (DCTN1)
   05016 Huntington disease
    1639 (DCTN1)
   05022 Pathways of neurodegeneration - multiple diseases
    1639 (DCTN1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    1639 (DCTN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1639 (DCTN1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    1639 (DCTN1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    1639 (DCTN1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    1639 (DCTN1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     1639 (DCTN1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     1639 (DCTN1)
SSDB
Motif
Pfam: Dynactin CAP_GLY Filament
Other DBs
NCBI-GeneID: 1639
NCBI-ProteinID: NP_004073
OMIM: 601143
HGNC: 2711
Ensembl: ENSG00000204843
Vega: OTTHUMG00000129963
Pharos: Q14203(Tbio)
UniProt: Q14203 Q6MZZ3
LinkDB
Structure
PDB: 

Position
2p13.1
AA seq 1278 aa
MAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGV
ILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKRE
GTDTTAKTSKLRGLKPKKAPTARKTTTRRPKPTRPASTGVAGASSSLGPSGSASAGELSS
SEPSTPAQTPLAAPIIPTPVLTSPGAVPPLPSPSKEEEGLRAQVRDLEEKLETLRLKRAE
DKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEMADT
ADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEKGSDGAASSYQL
KQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAE
STIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARE
TELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEA
SVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPG
GDHDCVLVLLLMPRLICKAELIRKQAQEKFELSENCSERPGLRGAAGEQLSFAAGLVYSL
SLLQATLHRYEHALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPL
TKAIKYYQHLYSIHLAEQPEDCTMQLADHIKFTQSALDCMSVEVGRLRAFLQGGQEATDI
ALLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGPQVSDTLLDCRKHLTWVVAV
LQEVAAAAAQLIAPLAENEGLLVAALEELAFKASEQIYGTPSSSPYECLRQSCNILISTM
NKLATAMQEGEYDAERPPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLK
IKGEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQ
ADIDQLEAEKAELKQRLNSQSKRTIEGLRGPPPSGIATLVSGIAGEEQQRGAIPGQAPGS
VPGPGLVKDSPLLLQQISAMRLHISQLQHENSILKGAQMKASLASLPPLHVAKLSHEGPG
SELPAGALYRKTSQLLETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVE
KLKDEVLKETVSQRPGATVPTDFATFPSSAFLRAKEEQQDDTVYMGKVTFSCAAGFGQRH
RLVLTQEQLHQLHSRLIS
NT seq 3837 nt   +upstreamnt  +downstreamnt
atggcacagagcaagaggcacgtgtacagccggacgcccagcggcagcaggatgagtgcg
gaggcaagcgcccggcctctgcgggtgggctcccgtgtagaggtgattggaaaaggccac
cgaggcactgtggcctatgttggagccacactgtttgccactggcaaatgggtaggcgtg
attctggatgaagcaaagggcaaaaatgatggaactgttcaaggcaggaagtacttcact
tgtgatgaagggcatggcatctttgtgcgccagtcccagatccaggtatttgaagatgga
gcagatactacttccccagagacacctgattcttctgcttcaaaagtcctcaaaagagag
ggaactgatacaactgcaaagactagcaaactgcggggactgaagcctaagaaggcaccg
acagcccgaaagaccacaactcggcgacccaagcccacgcgcccagccagtactggggtg
gctggggccagtagctccctgggcccctctggctcagcgtcagcaggtgagctgagcagc
agtgagcccagcaccccggctcagactccgctggcagcacccatcatccccacgccggtc
ctcacctctcctggagcagtccccccgcttccttccccatccaaggaggaggagggacta
agggctcaggtgcgggacctggaggagaaactagagaccctgagactgaaacgggcagaa
gacaaagcaaagctaaaagagctggagaaacacaaaatccagctggagcaggtgcaggaa
tggaagagcaaaatgcaggagcagcaggccgacctgcagcggcgcctcaaggaggcgaga
aaggaagccaaggaggcgctggaggcaaaggaacgctatatggaggagatggctgatact
gctgatgccattgagatggccactttggacaaggagatggctgaagagcgggctgagtcc
ctgcagcaggaggtggaggcactgaaggagcgggtggacgagctcactactgacttagag
atcctcaaggctgagattgaagagaagggctcagatggcgctgcatccagttatcagctc
aagcagcttgaggagcagaatgcccgcctgaaggatgccctggtgaggatgcgggatctt
tcttcctcagagaagcaggagcatgtgaagctccagaagctcatggaaaagaagaaccaa
gagctggaagttgtgaggcaacagcgggagcgtctgcaggaggagctaagccaggcagag
agcaccattgatgagctcaaggagcaggtggatgctgctctgggtgctgaggagatggtg
gagatgctgacagatcggaacctgaatctggaagagaaagtgcgcgagttgagggagact
gtgggagacttggaagcgatgaatgagatgaacgatgagctgcaggagaatgcacgtgag
acagaactggagctgcgggagcagctggacatggcaggcgcgcgggttcgtgaggcccag
aagcgtgtggaggcagcccaggagacggttgcagactaccagcagaccatcaagaagtac
cgccagctgaccgcccatctacaggatgtgaatcgggaactgacaaaccagcaggaagca
tctgtggagaggcaacagcagccacctccagagacctttgacttcaaaatcaagtttgct
gagactaaggcccatgccaaggcaattgagatggaattgaggcagatggaggtggcccag
gccaatcgacacatgtccctgctgacagccttcatgcctgacagcttccttcggccaggt
ggggaccatgactgcgttctggtgctgttgctcatgcctcgtctcatttgcaaggcagag
ctgatccggaagcaggcccaggagaagtttgaactaagtgagaactgttcagagcggcct
gggctgcgaggagctgctggggagcaactcagctttgctgctggactggtgtactcgctg
agcctgctgcaggccacgctacaccgctatgagcatgccctctctcagtgcagtgtggat
gtgtataagaaagtgggcagcctgtaccctgagatgagtgcccatgagcgctccttggat
ttcctcattgaactgctgcacaaggatcagctggatgagactgtcaatgtggagcctctc
accaaggccatcaagtactatcagcatctgtacagcatccaccttgccgaacagcctgag
gactgtactatgcagctggctgaccacattaagttcacgcagagtgctctggactgcatg
agtgtggaggtaggacggctgcgtgccttcttgcagggtgggcaggaggctacagatatt
gccctcctgctccgggatctggaaacttcatgcagtgacatccgccagttctgcaagaag
atccgaaggcgaatgccagggacagatgctcctgggatcccagctgcactggcctttgga
ccacaggtatctgacacgctcctagactgcaggaaacacttgacgtgggtcgtggctgtg
ctgcaggaggtggcagctgctgctgcccagctcattgccccactggcagagaatgagggg
ctacttgtggctgctctggaggaactggctttcaaagcaagcgagcagatctatgggacc
ccctccagcagcccctatgagtgtctgcgccagtcatgcaacatcctcatcagtaccatg
aacaagctggccacagccatgcaggagggggagtatgatgcagagcggccccccagcaag
cctccaccggttgaactgcgggctgctgcccttcgtgcagagatcacagatgctgaaggc
ctgggtttgaagctcgaagatcgagagacagttattaaggagttgaagaagtcactcaag
attaagggagaggagctaagtgaggccaatgtgcggctgagcctcctggagaagaagttg
gacagtgctgccaaggatgcagatgagcgcatcgagaaagtccagactcggctggaggag
acccaggcactgctgcgaaagaaggagaaagagtttgaggagacaatggatgcactccag
gctgacatcgaccagctggaggcagagaaggcagaactaaagcagcgtctgaacagccag
tccaaacgcacgattgagggactccggggccctcctccttcaggcattgctactctggtc
tctggcattgctggtgaagaacagcagcgaggagccatccctgggcaggctccagggtct
gtgccaggcccagggctggtgaaggactcaccactgctgcttcagcagatctctgccatg
aggctgcacatctcccagctccagcatgagaacagcatcctcaagggagcccagatgaag
gcatccttggcatccctgccccctctgcatgttgcaaagctatcccatgagggccctggc
agtgagttaccagctggagcgctgtatcgtaagaccagccagctgctggagacattgaat
caattgagcacacacacgcacgtagtagacatcactcgcaccagccctgctgccaagagc
ccgtcggcccaacttatggagcaagtggctcagcttaagtccctgagtgacaccgtcgag
aagctcaaggatgaggtcctcaaggagacagtatctcagcgccctggagccacagtaccc
actgactttgccaccttcccttcatcagccttcctcagggccaaggaggagcagcaggat
gacacagtctacatgggcaaagtgaccttctcatgtgcggctggttttggacagcgacac
cggctggtgctgacccaggagcagctgcaccagcttcacagtcgcctcatctcctaa

KEGG   Homo sapiens (human): 51164
Entry
51164             CDS       T01001                                 

Gene name
DCTN4, DYN4, P62
Definition
(RefSeq) dynactin subunit 4
  KO
K10426  dynactin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04962  Vasopressin-regulated water reabsorption
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
N01295  Rab7-regulated microtubule minus-end directed transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    51164 (DCTN4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    51164 (DCTN4)
   05016 Huntington disease
    51164 (DCTN4)
   05022 Pathways of neurodegeneration - multiple diseases
    51164 (DCTN4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    51164 (DCTN4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    51164 (DCTN4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    51164 (DCTN4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     51164 (DCTN4)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     51164 (DCTN4)
SSDB
Motif
Pfam: Dynactin_p62
Other DBs
NCBI-GeneID: 51164
NCBI-ProteinID: NP_057305
OMIM: 614758
HGNC: 15518
Ensembl: ENSG00000132912
Vega: OTTHUMG00000130079
Pharos: Q9UJW0(Tbio)
UniProt: Q9UJW0 A0A0S2Z5D4 Q9NSJ5
LinkDB
Position
5q33.1
AA seq 460 aa
MASLLQSDRVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHEVDSHYCPSCLENMPS
AEAKLKKNRCANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRD
VGMADKSVASGGWQEPENPHTQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSD
KYGLGTRLQRPRAGASISTLAGLSLKEGEDQKEIKIEPAQAVDEVEPLPEDYYTRPVNLT
EVTTLQQRLLQPDFQPVCASQLYPRHKHLLIKRSLRCRKCEHNLSKPEFNPTSIKFKIQL
VAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLFECEEGDPDDINSTAKVVV
PPKELVLAGKDAAAEYDELAEPQDFQDDPDIIAFRKANKVGIFIKVTPQREEGEVTVCFK
MKHDFKNLAAPIRPIEESDQGTEVIWLTQHVELSLGPLLP
NT seq 1383 nt   +upstreamnt  +downstreamnt
atggcgtccttgctgcagtcggaccgggttctctatctagtccagggagaaaagaaggtt
cgggccccgctctcgcaactctacttctgccgctattgtagcgaactgcggtcgctggaa
tgtgtgtctcacgaggtggactcccattattgtcccagttgtttagaaaatatgccatcg
gctgaagccaaactaaaaaagaatagatgtgccaattgttttgactgtcctggctgcatg
cacaccctctctactcgggccacgagcatctccacacagcttccagatgacccagccaag
accaccatgaagaaagcctattacctggcatgtggattttgtcgctggacgtctagagat
gtgggcatggcagacaaatctgtagctagtggcggttggcaggaacctgaaaatcctcac
acacaacggatgaacaaattgattgaatattaccagcagcttgctcagaaagagaaggtt
gagcgagatcgcaagaaactggcacgacgtagaaactatatgcctctggctttttcggac
aaatatggtcttggaaccaggcttcagcgaccacgagctggtgcatccatcagtaccctt
gccggactttcccttaaagaaggagaggatcagaaagagataaagattgagccagctcag
gctgtggatgaagtggaacctctacctgaagactattatacaagaccagtaaatttaaca
gaggtaacaacccttcagcagcgtctgttacagcctgacttccagccagtctgtgcttca
cagctctatcctcgccacaaacatcttctgatcaaacggtccctgcgctgccgtaaatgt
gaacataatttgagcaagccagaatttaacccaacgtcaatcaaattcaaaatccagctg
gtcgctgtcaattatattccagaagtgagaatcatgtcaattcccaaccttcgctacatg
aaggagagccaggtcctcctgactcttacaaatccagttgagaacctcacccatgtgact
ctcttcgagtgtgaggagggggaccctgatgatatcaacagcactgctaaggtggtggtg
cctcccaaagagctcgttttagctggcaaggatgcagcagcagagtacgatgagttggca
gaacctcaagactttcaggacgatcctgacattatagccttcagaaaggccaacaaagtg
ggtattttcatcaaagttacaccacagcgtgaggagggtgaagtgaccgtgtgcttcaag
atgaagcatgattttaaaaacctggcagcccccattcgccccattgaagaaagtgaccag
ggaacagaagtcatctggctcacccagcatgtggaacttagcttgggcccacttcttcct
taa

KEGG   Homo sapiens (human): 55860
Entry
55860             CDS       T01001                                 

Gene name
ACTR10, ACTR11, Arp10, Arp11, HARP11
Definition
(RefSeq) actin related protein 10
  KO
K16576  actin-related protein 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
N01295  Rab7-regulated microtubule minus-end directed transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    55860 (ACTR10)
   05016 Huntington disease
    55860 (ACTR10)
   05022 Pathways of neurodegeneration - multiple diseases
    55860 (ACTR10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    55860 (ACTR10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    55860 (ACTR10)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    55860 (ACTR10)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     55860 (ACTR10)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actin-related proteins
     55860 (ACTR10)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 55860
NCBI-ProteinID: NP_060947
HGNC: 17372
Ensembl: ENSG00000131966
Vega: OTTHUMG00000171049
Pharos: Q9NZ32(Tdark)
UniProt: Q9NZ32
LinkDB
Position
14q23.1
AA seq 417 aa
MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKRAGMPKPVRVVQYNIN
TEELYSYLKEFIHILYFRHLLVNPRDRRVVIIESVLCPSHFRETLTRVLFKYFEVPSVLL
APSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLL
EQCTVDTSVAKEQSLPSVMGSVPEGVLEDIKARTCFVSDLKRGLKIQAAKFNIDGNNERP
SPPPNVDYPLDGEKILHILGSIRDSVVEILFEQDNEEQSVATLILDSLIQCPIDTRKQLA
ENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKALGTKTFRIHTPPAKANCVAWLGGAI
FGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMMFDVGKTQPPLMKRAFSTEK
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgccgctctacgagggcctggggagcggcggggagaagacggcggtcgtgatcgacctg
ggagaggcctttaccaagtgtggatttgctggagaaactggtccaagatgtataattcct
agtgtgataaaaagagctgggatgcctaagcctgtcagagttgttcagtataatatcaat
acagaagaattatattcctacctaaaggaattcatccacatactatatttcaggcatcta
ttggtgaatcccagagaccgccgagttgtgattatcgaatcggtattatgtccttctcac
ttcagagagacactcactcgtgttcttttcaaatattttgaggttccatctgtcttgctt
gctccaagtcatctaatggctcttctgacgcttggaattaattctgccatggtcctagat
tgtggatatagggaaagcctggtgttacccatatatgaaggaatcccagttctaaattgt
tggggagcactacccctaggaggaaaagctcttcacaaagagttggaaactcaactattg
gaacaatgtactgttgacacaagtgttgctaaagaacagagccttccctcagtgatgggt
tcagttccggaaggtgtcttagaggacattaaagcgcgtacttgctttgtaagtgatctg
aagcgaggactaaaaatccaagcagcaaaatttaatattgatgggaataatgagcgtccc
tccccacccccaaatgttgactatccattagatggagagaagattttacatatccttgga
tcaatcagagattcagttgtggaaattctttttgaacaagataatgaagagcaatcagtt
gccactttaatattggattcccttatacagtgtccgatagacaccaggaagcaactagca
gagaatttggtagtcataggtggcacttctatgttgccaggatttctccacagattgctt
gcagaaataaggtatttggtagaaaaaccaaaatataaaaaagcacttggcactaagaca
tttcgaattcatactccacctgcaaaagctaattgtgtggcctggttgggaggggctatt
tttggagcattacaagatatacttgggagccgttctgtttcaaaggaatattataatcag
acgggccgtatacctgattggtgttctctcaataacccacctttggaaatgatgtttgat
gtcgggaaaactcaaccacctctgatgaagagagcattttccactgagaaatag

KEGG   Homo sapiens (human): 84516
Entry
84516             CDS       T01001                                 

Gene name
DCTN5
Definition
(RefSeq) dynactin subunit 5
  KO
K10427  dynactin 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04962  Vasopressin-regulated water reabsorption
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
N01295  Rab7-regulated microtubule minus-end directed transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    84516 (DCTN5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    84516 (DCTN5)
   05016 Huntington disease
    84516 (DCTN5)
   05022 Pathways of neurodegeneration - multiple diseases
    84516 (DCTN5)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    84516 (DCTN5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    84516 (DCTN5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    84516 (DCTN5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     84516 (DCTN5)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     84516 (DCTN5)
SSDB
Motif
Pfam: Hexapep Hexapep_2 DUF4954 Fucokinase
Other DBs
NCBI-GeneID: 84516
NCBI-ProteinID: NP_115875
OMIM: 612962
HGNC: 24594
Ensembl: ENSG00000166847
Vega: OTTHUMG00000131610
Pharos: Q9BTE1(Tdark)
UniProt: Q9BTE1
LinkDB
Position
16p12.2
AA seq 182 aa
MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRH
CVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRC
VLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLT
QV
NT seq 549 nt   +upstreamnt  +downstreamnt
atggagttgggcgagctgctctacaacaagtctgagtacatcgagacggcatctgggaac
aaagtcagtcgccagtcagtgttgtgtggaagccagaacatcgttctcaatggcaagacc
attgtgatgaatgactgtattatccgaggggatctggcaaatgtaagagttggacgtcat
tgtgttgtgaaaagtcgtagtgtcataaggccaccattcaagaagttcagcaaaggtgtt
gcattctttcctttacatattggagaccatgtctttattgaggaagattgtgtggtcaac
gcagcacagattggttcctatgttcatgttgggaagaactgtgtgattgggcgccgatgt
gtgttgaaagactgctgcaaaattcttgacaacacagtattacctccagaaactgtggtt
ccaccattcactgtcttctcaggctgcccaggactcttctcaggggagctcccggagtgc
actcaggagctgatgattgacgtcaccaagagctactaccagaagtttttgcccctgacg
caagtctag

DBGET integrated database retrieval system