KEGG   Homo sapiens (human): 10121
Entry
10121             CDS       T01001                                 

Gene name
ACTR1A, ARP1, Arp1A, CTRN1
Definition
(RefSeq) actin related protein 1A
  KO
K16575  centractin
Organism
hsa  Homo sapiens (human)
Pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
N01295  Rab7-regulated microtubule minus-end directed transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    10121 (ACTR1A)
   05016 Huntington disease
    10121 (ACTR1A)
   05022 Pathways of neurodegeneration - multiple diseases
    10121 (ACTR1A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    10121 (ACTR1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10121 (ACTR1A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10121 (ACTR1A)
   04147 Exosome [BR:hsa04147]
    10121 (ACTR1A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     10121 (ACTR1A)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actin-related proteins
     10121 (ACTR1A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   10121 (ACTR1A)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 10121
NCBI-ProteinID: NP_005727
OMIM: 605143
HGNC: 167
Ensembl: ENSG00000138107
Vega: OTTHUMG00000018956
Pharos: P61163(Tbio)
UniProt: P61163 A0A384NQ21
LinkDB
Position
10q24.32
AA seq 376 aa
MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGP
KAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKN
RERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSI
MRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQ
YYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVL
SGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSK
KEYEEDGARSIHRKTF
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggagtcctacgatgtgatcgccaaccagcctgtcgtgatcgacaacggatccggtgtg
attaaagctggttttgctggtgatcagatccccaaatactgctttccaaactatgtgggc
cgacccaagcacgttcgtgtcatggcaggagcccttgaaggcgacatcttcattggcccc
aaagctgaggagcaccgagggctgctttcaatccgctatcccatggagcatggcatcgtc
aaggattggaacgacatggaacgcatttggcaatatgtctattctaaggaccagctgcag
actttctcagaggagcatcctgtgctcctgactgaggcgcctttaaacccacgaaaaaac
cgggaacgagctgccgaagttttcttcgagaccttcaatgtgcccgctcttttcatctcc
atgcaagctgtactcagcctttacgctacaggcaggaccacaggggtggtgctggattct
ggggatggagtcacccatgctgtgcccatctatgagggctttgccatgccccactccatc
atgcgcatcgacatcgcgggccgggacgtctctcgcttcctgcgcctctacctgcgtaag
gagggctacgacttccactcatcctctgagtttgagattgtcaaggccataaaagaaaga
gcctgttacctatccataaacccccaaaaggatgagacgctagagacagagaaagctcag
tactacctgcctgatggcagcaccattgagattggtccttcccgattccgggcccctgag
ttgctcttcaggccagatttgattggagaggagagtgaaggcatccacgaggtcctggtg
ttcgccattcagaagtcagacatggacctgcggcgcacgcttttctctaacattgtcctc
tcaggaggctctaccctgttcaaaggttttggtgacaggctcctgagtgaagtgaagaaa
ctagctccaaaagatgtgaagatcaggatatctgcacctcaggagagactgtattccacg
tggattgggggctccatccttgcctccctggacacctttaagaagatgtgggtctccaaa
aaggaatatgaggaagacggtgcccgatccatccacagaaaaaccttctaa

DBGET integrated database retrieval system