KEGG   Homo sapiens (human): 10124Help
Entry
10124             CDS       T01001                                 

Gene name
ARL4A, ARL4
Definition
(RefSeq) ADP ribosylation factor like GTPase 4A
  KO
K07945  ADP-ribosylation factor-like protein 4
Organism
hsa  Homo sapiens (human)
Brite
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arl4/Arl7
    10124 (ARL4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf Ras Roc SRPRB G-alpha MMR_HSR1 GTP_EFTU Gtr1_RagA ATP_bind_1 6PF2K AAA_28 RsgA_GTPase DLIC NTPase_1
Motif
Other DBs
NCBI-GeneID: 10124
NCBI-ProteinID: NP_001032241
OMIM: 604786
HGNC: 695
Ensembl: ENSG00000122644
Vega: OTTHUMG00000023374
Pharos: P40617(Tbio)
UniProt: P40617 A0A024R9Z2
LinkDB All DBs
Position
7p21.3
AA seq 200 aa AA seqDB search
MGNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIK
VTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITR
ISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLE
KLHDMIIKRRKMLRQQKKKR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggggaatgggctgtcagaccagacttctatcctgtccaacctgccttcatttcagtct
ttccacattgttattctgggtttggactgtgctggaaagacaactgtcttatacaggctg
cagttcaatgaatttgtaaataccgtacctaccaaaggatttaacactgagaaaattaag
gtaaccttgggaaattctaaaacagtcacttttcacttctgggatgtaggtggtcaggag
aaattaaggccactgtggaagtcatataccagatgcacagatggcattgtatttgttgtg
gactctgttgatgtcgaaaggatggaagaagccaaaactgaacttcacaaaataactagg
atatcagaaaatcagggagtccctgtacttatagttgctaacaaacaagatttgaggaac
tcattgtcactttcagaaattgagaaattgttagcaatgggtgaactgagctcatcaact
ccttggcatttgcagcctacctgtgcaatcataggagatggcctaaaggaaggacttgag
aaactacatgatatgatcattaaaagaagaaaaatgttgcggcaacagaaaaagaaaaga
tga

DBGET integrated database retrieval system