KEGG   Homo sapiens (human): 10161
Entry
10161             CDS       T01001                                 

Gene name
LPAR6, ARWH1, HYPT8, LAH3, LPA-6, P2RY5, P2Y5
Definition
(RefSeq) lysophosphatidic acid receptor 6
  KO
K04273  lysophosphatidic acid receptor 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa05200  Pathways in cancer
Disease
H00667  Woolly hair
H00784  Localized autosomal recessive hypotrichosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    10161 (LPAR6)
   04151 PI3K-Akt signaling pathway
    10161 (LPAR6)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    10161 (LPAR6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    10161 (LPAR6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    10161 (LPAR6)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    10161 (LPAR6)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 10161
NCBI-ProteinID: NP_001155969
OMIM: 609239
HGNC: 15520
Ensembl: ENSG00000139679
Vega: OTTHUMG00000016895
Pharos: P43657(Tchem)
UniProt: P43657 B3KVQ5 A0A024RDT2
LinkDB
Position
13q14.2
AA seq 344 aa
MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLA
MSDLLFVFTLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVY
PFKSKTLRTKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTY
LSRIVIFIEIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCF
CFVPYNINLILYSLVRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQN
SIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESAA
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggtaagcgttaacagctcccactgcttctataatgactcctttaagtacactttgtat
gggtgcatgttcagcatggtgtttgtgcttgggttaatatccaattgtgttgccatatac
attttcatctgcgtcctcaaagtccgaaatgaaactacaacttacatgattaacttggca
atgtcagacttgctttttgtttttactttacccttcaggattttttacttcacaacacgg
aattggccatttggagatttactttgtaagatttctgtgatgctgttttataccaacatg
tacggaagcattctgttcttaacctgtattagtgtagatcgatttctggcaattgtctac
ccatttaagtcaaagactctaagaaccaaaagaaatgcaaagattgtttgcactggcgtg
tggttaactgtgatcggaggaagtgcacccgccgtttttgttcagtctacccactctcag
ggtaacaatgcctcagaagcctgctttgaaaattttccagaagccacatggaaaacatat
ctctcaaggattgtaattttcatcgaaatagtgggattttttattcctctaattttaaat
gtaacttgttctagtatggtgctaaaaactttaaccaaacctgttacattaagtagaagc
aaaataaacaaaactaaggttttaaaaatgatttttgtacatttgatcatattctgtttc
tgttttgttccttacaatatcaatcttattttatattctcttgtgagaacacaaacattt
gttaattgctcagtagtggcagcagtaaggacaatgtacccaatcactctctgtattgct
gtttccaactgttgttttgaccctatagtttactactttacatcggacacaattcagaat
tcaataaaaatgaaaaactggtctgtcaggagaagtgacttcagattctctgaagttcat
ggtgcagagaattttattcagcataacctacagaccttaaaaagtaagatatttgacaat
gaatctgctgcctga

KEGG   Homo sapiens (human): 27334
Entry
27334             CDS       T01001                                 

Gene name
P2RY10, LYPSR2, P2Y10
Definition
(RefSeq) P2Y receptor family member 10
  KO
K04274  P2Y purinoceptor 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    27334 (P2RY10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    27334 (P2RY10)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Lysophosphatidylserine
    27334 (P2RY10)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 27334
NCBI-ProteinID: NP_001311147
OMIM: 300529
HGNC: 19906
Ensembl: ENSG00000078589
Vega: OTTHUMG00000021896
Pharos: O00398(Tdark)
UniProt: O00398
LinkDB
Position
Xq21.1
AA seq 339 aa
MANLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLC
RFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYISHHWPFQRALCLLCFYLKYLNMYAS
ICFLTCISLQRCFFLLKPFRARDWKRRYDVGISAAIWIVVGTACLPFPILRSTDLNNNKS
CFADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQK
ALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLL
DPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggctaaccttgacaaatacactgaaacattcaagatgggtagcaacagtaccagcact
gctgagatttactgtaatgtcactaatgtgaaatttcaatactccctctatgcaaccacc
tatatcctcatattcattcctggtcttctggctaacagtgcagccttgtgggttctgtgc
cgcttcatcagcaagaaaaataaagccatcattttcatgatcaacctctctgtggctgac
cttgctcatgtattatctttacccctccggatttactattacatcagccaccactggcct
ttccagagagccctttgcctgctctgcttctacctgaagtatctcaacatgtatgccagc
atttgtttcctgacgtgcatcagtcttcaaaggtgcttttttctcctcaagcccttcagg
gccagagactggaagcgtaggtacgatgtgggcatcagtgctgccatctggatcgttgtg
gggactgcctgtttgccatttcccatcctgagaagcacagacttaaacaacaacaagtcc
tgctttgctgatcttggatacaagcaaatgaatgcagttgcgttggtcgggatgattaca
gttgctgagcttgcaggatttgtgatcccagtgatcatcatcgcatggtgtacctggaaa
actactatatccttgagacagccaccaatggctttccaagggatcagtgagaggcagaaa
gcactgcggatggtgttcatgtgtgctgcagtcttcttcatctgcttcactccctatcat
attaactttattttttacaccatggtaaaggaaaccatcattagcagttgtcccgttgtc
cgaatcgcactgtatttccaccctttttgcctgtgccttgcaagtctctgctgccttttg
gatccaattctttattactttatggcttcagagtttcgtgaccaactatcccgccatggc
agttctgtgacccgctcccgcctcatgagcaaggagagtggttcatcaatgattggctaa

KEGG   Homo sapiens (human): 2846
Entry
2846              CDS       T01001                                 

Gene name
LPAR4, GPR23, LPA4, P2RY9, P2Y5-LIKE, P2Y9
Definition
(RefSeq) lysophosphatidic acid receptor 4
  KO
K04275  lysophosphatidic acid receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05200  Pathways in cancer
Network
nt06124  Chemokine signaling (viruses)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00408  LPAR-GNB/G-Rho signaling pathway
N01097  LPA-GNA12/13-RhoA signaling pathway
N01104  LPA-GNAQ/11-RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    2846 (LPAR4)
   04072 Phospholipase D signaling pathway
    2846 (LPAR4)
   04151 PI3K-Akt signaling pathway
    2846 (LPAR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2846 (LPAR4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2846 (LPAR4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2846 (LPAR4)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    2846 (LPAR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2846 (LPAR4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    2846 (LPAR4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx Serpentine_r_xa 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 2846
NCBI-ProteinID: NP_001264929
OMIM: 300086
HGNC: 4478
Ensembl: ENSG00000147145
Vega: OTTHUMG00000021895
Pharos: Q99677(Tchem)
UniProt: Q99677
LinkDB
Position
Xq21.1
AA seq 370 aa
MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVS
LFVFCFRMKMRSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLT
NIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTN
VNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQI
GTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCFLERFAKIMYPITLCLA
TLNCCFDPFIYYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNN
GGELMLESTF
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgggtgacagaagattcattgacttccaattccaagattcaaattcaagcctcagaccc
aggttgggcaatgctactgccaataatacttgcattgttgatgattccttcaagtataat
ctcaatggtgctgtctacagtgttgtattcatcttgggtctgataaccaacagtgtctct
ctgtttgtcttctgtttccgcatgaaaatgagaagtgagactgctatttttatcaccaat
ctagctgtctctgatttgctttttgtctgtacactaccttttaaaatattttacaacttc
aaccgccactggccttttggtgacaccctctgcaagatctctggaactgcattccttacc
aacatctatgggagcatgctctttctcacctgtattagtgtggatcgtttcctggccatt
gtctatccttttcgatctcgtactattaggactaggaggaattctgccattgtgtgtgct
ggtgtctggatcctagtcctcagtggcggtatttcagcctctttgttttccaccactaat
gtcaacaatgcaaccaccacctgctttgaaggcttctccaaacgtgtctggaagacttat
ttatccaagatcacaatatttattgaagttgttgggtttatcattcctctaatattgaat
gtctcttgctcttctgtggtgctgagaactcttcgcaagcctgctactctgtctcaaatt
gggaccaataagaaaaaagtactgaaaatgatcacagtacatatggcagtctttgtggta
tgctttgtaccctacaactctgtcctcttcttgtatgccctggtgcgctcccaagctatt
actaattgctttttggaaagatttgcaaagatcatgtacccaatcaccttgtgccttgca
actctgaactgttgttttgaccctttcatctattacttcacccttgaatcctttcagaag
tccttctacatcaatgcccacatcagaatggagtccctgtttaagactgaaacacctttg
accacaaagccttcccttccagctattcaagaggaagtgagtgatcaaacaacaaataat
ggtggtgaattaatgctagaatccaccttttag

KEGG   Homo sapiens (human): 2859
Entry
2859              CDS       T01001                                 

Gene name
GPR35
Definition
(RefSeq) G protein-coupled receptor 35
  KO
K04276  C-X-C chemokine receptor type 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2859 (GPR35)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2859 (GPR35)
   04050 Cytokine receptors [BR:hsa04050]
    2859 (GPR35)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    2859 (GPR35)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CXC Chemokine
   2859 (GPR35)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 2859
NCBI-ProteinID: NP_005292
OMIM: 602646
HGNC: 4492
Ensembl: ENSG00000178623
Vega: OTTHUMG00000133356
Pharos: Q9HC97(Tchem)
UniProt: Q9HC97 A8K2J1 B2RA17
LinkDB
Position
2q37.3
AA seq 309 aa
MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMT
NLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRH
PLRARGLRSPRQAAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGF
YLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVR
LAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKS
QDSLCVTLA
NT seq 930 nt   +upstreamnt  +downstreamnt
atgaatggcacctacaacacctgtggctccagcgacctcacctggcccccagcgatcaag
ctgggcttctacgcctacttgggcgtcctgctggtgctaggcctgctgctcaacagcctg
gcgctctgggtgttctgctgccgcatgcagcagtggacggagacccgcatctacatgacc
aacctggcggtggccgacctctgcctgctgtgcaccttgcccttcgtgctgcactccctg
cgagacacctcagacacgccgctgtgccagctctcccagggcatctacctgaccaacagg
tacatgagcatcagcctggtcacggccatcgccgtggaccgctatgtggccgtgcggcac
ccgctgcgtgcccgcgggctgcggtcccccaggcaggctgcggccgtgtgcgcggtcctc
tgggtgctggtcatcggctccctggtggctcgctggctcctggggattcaggagggcggc
ttctgcttcaggagcacccggcacaatttcaactccatggcgttcccgctgctgggattc
tacctgcccctggccgtggtggtcttctgctccctgaaggtggtgactgccctggcccag
aggccacccaccgacgtggggcaggcagaggccacccgcaaggctgcccgcatggtctgg
gccaacctcctggtgttcgtggtctgcttcctgcccctgcacgtggggctgacagtgcgc
ctcgcagtgggctggaacgcctgtgccctcctggagacgatccgtcgcgccctgtacata
accagcaagctctcagatgccaactgctgcctggacgccatctgctactactacatggcc
aaggagttccaggaggcgtctgcactggccgtggctcccagtgctaaggcccacaaaagc
caggactctctgtgcgtgaccctcgcctaa

KEGG   Homo sapiens (human): 286530
Entry
286530            CDS       T01001                                 

Gene name
P2RY8, P2Y8
Definition
(RefSeq) P2Y receptor family member 8
  KO
K08386  P2Y purinoceptor 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    286530 (P2RY8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    286530 (P2RY8)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    286530 (P2RY8)
SSDB
Motif
Pfam: 7tm_1 DUF2127 UPF0542
Other DBs
NCBI-GeneID: 286530
NCBI-ProteinID: NP_835230
OMIM: 300525
HGNC: 15524
Ensembl: ENSG00000182162
Vega: OTTHUMG00000021060
Pharos: Q86VZ1(Tbio)
UniProt: Q86VZ1
LinkDB
Position
Xp22.33 and Yp11.3
AA seq 359 aa
MQVPNSTGPDNATLQMLRNPAIAVALPVVYSLVAAVSIPGNLFSLWVLCRRMGPRSPSVI
FMINLSVTDLMLASVLPFQIYYHCNRHHWVFGVLLCNVVTVAFYANMYSSILTMTCISVE
RFLGVLYPLSSKRWRRRRYAVAACAGTWLLLLTALSPLARTDLTYPVHALGIITCFDVLK
WTMLPSVAMWAVFLFTIFILLFLIPFVITVACYTATILKLLRTEEAHGREQRRRAVGLAA
VVLLAFVTCFAPNNFVLLAHIVSRLFYGKSYYHVYKLTLCLSCLNNCLDPFVYYFASREF
QLRLREYLGCRRVPRDTLDTRRESLFSARTTSVRSEAGAHPEGMEGATRPGLQRQESVF
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgcaggtcccgaacagcaccggcccggacaacgcgacgctgcagatgctgcggaacccg
gcgatcgcggtggccctgcccgtggtgtactcgctggtggcggcggtcagcatcccgggc
aacctcttctctctgtgggtgctgtgccggcgcatggggcccagatccccgtcggtcatc
ttcatgatcaacctgagcgtcacggacctgatgctggccagcgtgttgcctttccaaatc
tactaccattgcaaccgccaccactgggtattcggggtgctgctttgcaacgtggtgacc
gtggccttttacgcaaacatgtattccagcatcctcaccatgacctgtatcagcgtggag
cgcttcctgggggtcctgtacccgctcagctccaagcgctggcgccgccgtcgttacgcg
gtggccgcgtgtgcagggacctggctgctgctcctgaccgccctgtccccgctggcgcgc
accgatctcacctacccggtgcacgccctgggcatcatcacctgcttcgacgtcctcaag
tggacgatgctccccagcgtggccatgtgggccgtgttcctcttcaccatcttcatcctg
ctgttcctcatcccgttcgtgatcaccgtggcttgttacacggccaccatcctcaagctg
ttgcgcacggaggaggcgcacggccgggagcagcggaggcgcgcggtgggcctggccgcg
gtggtcttgctggcctttgtcacctgcttcgcccccaacaacttcgtgctcctggcgcac
atcgtgagccgcctgttctacggcaagagctactaccacgtgtacaagctcacgctgtgt
ctcagctgcctcaacaactgtctggacccgtttgtttattactttgcgtcccgggaattc
cagctgcgcctgcgggaatatttgggctgccgccgggtgcccagagacaccctggacacg
cgccgcgagagcctcttctccgccaggaccacgtccgtgcgctccgaggccggtgcgcac
cctgaagggatggagggagccaccaggcccggcctccagaggcaggagagtgtgttctga

KEGG   Homo sapiens (human): 5028
Entry
5028              CDS       T01001                                 

Gene name
P2RY1, P2Y1, SARCC
Definition
(RefSeq) purinergic receptor P2Y1
  KO
K04270  P2Y purinoceptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04611  Platelet activation
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    5028 (P2RY1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5028 (P2RY1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5028 (P2RY1)
  09157 Sensory system
   04742 Taste transduction
    5028 (P2RY1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    5028 (P2RY1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    5028 (P2RY1)
SSDB
Motif
Pfam: 7tm_1 DUF996 DUF4014 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 5028
NCBI-ProteinID: NP_002554
OMIM: 601167
HGNC: 8539
Ensembl: ENSG00000169860
Vega: OTTHUMG00000159694
Pharos: P47900(Tchem)
UniProt: P47900
LinkDB
Position
3q25.2
AA seq 373 aa
MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYIL
VFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG
DAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLIVV
VAISPILFYSGTGVRKNKTITCYDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLI
VRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFND
RVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLN
ILPEFKQNGDTSL
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgaccgaggtgctgtggccggctgtccccaacgggacggacgctgccttcctggccggt
ccgggttcgtcctgggggaacagcacggtcgcctccactgccgccgtctcctcgtcgttc
aaatgcgccttgaccaagacgggcttccagttttactacctgccggctgtctacatcttg
gtattcatcatcggcttcctgggcaacagcgtggccatctggatgttcgtcttccacatg
aagccctggagcggcatctccgtgtacatgttcaatttggctctggccgacttcttgtac
gtgctgactctgccagccctgatcttctactacttcaataaaacagactggatcttcggg
gatgccatgtgtaaactgcagaggttcatctttcatgtgaacctctatggcagcatcttg
tttctgacatgcatcagtgcccaccggtacagcggtgtggtgtaccccctcaagtccctg
ggccggctcaaaaagaagaatgcgatctgtatcagcgtgctggtgtggctcattgtggtg
gtggcgatctcccccatcctcttctactcaggtaccggggtccgcaaaaacaaaaccatc
acctgttacgacaccacctcagacgagtacctgcgaagttatttcatctacagcatgtgc
acgaccgtggccatgttctgtgtccccttggtgctgattctgggctgttacggattaatt
gtgagagctttgatttacaaagatctggacaactctcctctgaggagaaaatcgatttac
ctggtaatcattgtactgactgtttttgctgtgtcttacatccctttccatgtgatgaaa
acgatgaacttgagggcccggcttgattttcagaccccagcaatgtgtgctttcaatgac
agggtttatgccacgtatcaggtgacaagaggtctagcaagtctcaacagttgtgtggac
cccattctctatttcttggcgggagatactttcagaaggagactctcccgagccacaagg
aaagcttctagaagaagtgaggcaaatttgcaatccaagagtgaagacatgaccctcaat
attttacctgagttcaagcagaatggagatacaagcctgtga

KEGG   Homo sapiens (human): 5029
Entry
5029              CDS       T01001                                 

Gene name
P2RY2, HP2U, P2RU1, P2U, P2U1, P2UR, P2Y2, P2Y2R
Definition
(RefSeq) purinergic receptor P2Y2
  KO
K04269  P2Y purinoceptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04750  Inflammatory mediator regulation of TRP channels
Drug target
Denufosol tetrasodium: D03685
Diquafosol tetrasodium: D03864<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5029 (P2RY2)
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5029 (P2RY2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    5029 (P2RY2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    5029 (P2RY2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 5029
NCBI-ProteinID: NP_002555
OMIM: 600041
HGNC: 8541
Ensembl: ENSG00000175591
Vega: OTTHUMG00000167966
Pharos: P41231(Tclin)
UniProt: P41231
LinkDB
Position
11q13.4
AA seq 377 aa
MAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVPGLCLNAVALYIFLC
RLKTWNASTTYMFHLAVSDALYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCS
ILFLTCISVHRCLGVLRPLRSLRWGRARYARRVAGAVWVLVLACQAPVLYFVTTSARGGR
VTCHDTSAPELFSRFVAYSSVMLGLLFAVPFAVILVCYVLMARRLLKPAYGTSGGLPRAK
RKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKVTRPLASANSC
LDPVLYFLAGQRLVRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSR
RTESTPAGSENTKDIRL
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcagcagacctgggcccctggaatgacaccatcaatggcacctgggatggggatgag
ctgggctacaggtgccgcttcaacgaggacttcaagtacgtgctgctgcctgtgtcctac
ggcgtggtgtgcgtgcctgggctgtgtctgaacgccgtggcgctctacatcttcttgtgc
cgcctcaagacctggaatgcgtccaccacatatatgttccacctggctgtgtctgatgca
ctgtatgcggcctccctgccgctgctggtctattactacgcccgcggcgaccactggccc
ttcagcacggtgctctgcaagctggtgcgcttcctcttctacaccaacctttactgcagc
atcctcttcctcacctgcatcagcgtgcaccggtgtctgggcgtcttacgacctctgcgc
tccctgcgctggggccgggcccgctacgctcgccgggtggccggggccgtgtgggtgttg
gtgctggcctgccaggcccccgtgctctactttgtcaccaccagcgcgcgcgggggccgc
gtaacctgccacgacacctcggcacccgagctcttcagccgcttcgtggcctacagctca
gtcatgctgggcctgctcttcgcggtgccctttgccgtcatccttgtctgttacgtgctc
atggctcggcgactgctaaagccagcctacgggacctcgggcggcctgcctagggccaag
cgcaagtccgtgcgcaccatcgccgtggtgctggctgtcttcgccctctgcttcctgcca
ttccacgtcacccgcaccctctactactccttccgctcgctggacctcagctgccacacc
ctcaacgccatcaacatggcctacaaggttacccggccgctggccagtgctaacagttgc
cttgaccccgtgctctacttcctggctgggcagaggctcgtacgctttgcccgagatgcc
aagccacccactggccccagccctgccaccccggctcgccgcaggctgggcctgcgcaga
tccgacagaactgacatgcagaggatagaagatgtgttgggcagcagtgaggactctagg
cggacagagtccacgccggctggtagcgagaacactaaggacattcggctgtag

KEGG   Homo sapiens (human): 5030
Entry
5030              CDS       T01001                                 

Gene name
P2RY4, NRU, P2P, P2Y4, UNR
Definition
(RefSeq) pyrimidinergic receptor P2Y4
  KO
K04271  P2Y purinoceptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5030 (P2RY4)
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    5030 (P2RY4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    5030 (P2RY4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    5030 (P2RY4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 5030
NCBI-ProteinID: NP_002556
OMIM: 300038
HGNC: 8542
Ensembl: ENSG00000186912
Vega: OTTHUMG00000021769
Pharos: P51582(Tchem)
UniProt: P51582
LinkDB
Position
Xq13.1
AA seq 365 aa
MASTESSLLRSLGLSPGPGSSEVELDCWFDEDFKFILLPVSYAVVFVLGLGLNAPTLWLF
IFRLRPWDATATYMFHLALSDTLYVLSLPTLIYYYAAHNHWPFGTEICKFVRFLFYWNLY
CSVLFLTCISVHRYLGICHPLRALRWGRPRLAGLLCLAVWLVVAGCLVPNLFFVTTSNKG
TTVLCHDTTRPEEFDHYVHFSSAVMGLLFGVPCLVTLVCYGLMARRLYQPLPGSAQSSSR
LRSLRTIAVVLTVFAVCFVPFHITRTIYYLARLLEADCRVLNIVNVVYKVTRPLASANSC
LDPVLYLLTGDKYRRQLRQLCGGGKPQPRTAASSLALVSLPEDSSCRWAATPQDSSCSTP
RADRL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggccagtacagagtcctccctgttgagatccctaggcctcagcccaggtcctggcagc
agtgaggtggagctggactgttggtttgatgaggatttcaagttcatcctgctgcctgtg
agctatgcagttgtctttgtgctgggcttgggccttaacgccccaaccctatggctcttc
atcttccgcctccgaccctgggatgcaacggccacctacatgttccacctggcattgtca
gacaccttgtatgtgctgtcgctgcccaccctcatctactattatgcagcccacaaccac
tggccctttggcactgagatctgcaagttcgtccgctttcttttctattggaacctctac
tgcagtgtccttttcctcacctgcatcagcgtgcaccgctacctgggcatctgccaccca
cttcgggcactacgctggggccgccctcgcctcgcaggccttctctgcctggcagtttgg
ttggtcgtagccggctgcctcgtgcccaacctgttctttgtcacaaccagcaacaaaggg
accaccgtcctgtgccatgacaccactcggcctgaagagtttgaccactatgtgcacttc
agctcggcggtcatggggctgctctttggcgtgccctgcctggtcactcttgtttgctat
ggactcatggctcgtcgcctgtatcagcccttgccaggctctgcacagtcgtcttctcgc
ctccgctctctccgcaccatagctgtggtgctgactgtctttgctgtctgcttcgtgcct
ttccacatcacccgcaccatttactacctggccaggctgttggaagctgactgccgagta
ctgaacattgtcaacgtggtctataaagtgactcggcccctggccagtgccaacagctgc
ctggatcctgtgctctacttgctcactggggacaaatatcgacgtcagctccgtcagctc
tgtggtggtggcaagccccagccccgcacggctgcctcttccctggcactagtgtccctg
cctgaggatagcagctgcaggtgggcggccaccccccaggacagtagctgctctactcct
agggcagatagattgtaa

KEGG   Homo sapiens (human): 5031
Entry
5031              CDS       T01001                                 

Gene name
P2RY6, P2Y6
Definition
(RefSeq) pyrimidinergic receptor P2Y6
  KO
K04272  P2Y purinoceptor 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5031 (P2RY6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    5031 (P2RY6)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    5031 (P2RY6)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 5031
NCBI-ProteinID: NP_001264133
OMIM: 602451
HGNC: 8543
Ensembl: ENSG00000171631
Vega: OTTHUMG00000167969
Pharos: Q15077(Tchem)
UniProt: Q15077 A0A024R5I9
LinkDB
Position
11q13.4
AA seq 328 aa
MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTR
TAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCI
SFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDL
SPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARM
AVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPIL
FYFTQKKFRRRPHELLQKLTAKWQRQGR
NT seq 987 nt   +upstreamnt  +downstreamnt
atggaatgggacaatggcacaggccaggctctgggcttgccacccaccacctgtgtctac
cgcgagaacttcaagcaactgctgctgccacctgtgtattcggcggtgctggcggctggc
ctgccgctgaacatctgtgtcattacccagatctgcacgtcccgccgggccctgacccgc
acggccgtgtacaccctaaaccttgctctggctgacctgctatatgcctgctccctgccc
ctgctcatctacaactatgcccaaggtgatcactggccctttggcgacttcgcctgccgc
ctggtccgcttcctcttctatgccaacctgcacggcagcatcctcttcctcacctgcatc
agcttccagcgctacctgggcatctgccacccgctggccccctggcacaaacgtgggggc
cgccgggctgcctggctagtgtgtgtagccgtgtggctggccgtgacaacccagtgcctg
cccacagccatcttcgctgccacaggcatccagcgtaaccgcactgtctgctatgacctc
agcccgcctgccctggccacccactatatgccctatggcatggctctcactgtcatcggc
ttcctgctgccctttgctgccctgctggcctgctactgtctcctggcctgccgcctgtgc
cgccaggatggcccggcagagcctgtggcccaggagcggcgtggcaaggcggcccgcatg
gccgtggtggtggctgctgcctttgccatcagcttcctgccttttcacatcaccaagaca
gcctacctggcagtgcgctcgacgccgggcgtcccctgcactgtattggaggcctttgca
gcggcctacaaaggcacgcggccgtttgccagtgccaacagcgtgctggaccccatcctc
ttctacttcacccagaagaagttccgccggcgaccacatgagctcctacagaaactcaca
gccaaatggcagaggcagggtcgctga

KEGG   Homo sapiens (human): 5032
Entry
5032              CDS       T01001                                 

Gene name
P2RY11, P2Y11
Definition
(RefSeq) purinergic receptor P2Y11
  KO
K08387  P2Y purinoceptor 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5032 (P2RY11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    5032 (P2RY11)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    5032 (P2RY11)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srx TP_methylase
Other DBs
NCBI-GeneID: 5032
NCBI-ProteinID: NP_002557
OMIM: 602697
HGNC: 8540
Ensembl: ENSG00000244165
Vega: OTTHUMG00000150166
Pharos: Q96G91(Tbio)
UniProt: Q96G91
LinkDB
Position
19p13.2
AA seq 374 aa
MAANVSGAKSCPANFLAAADDKLSGFQGDFLWPILVVEFLVAVASNGLALYRFSIRKQRP
WHPAVVFSVQLAVSDLLCALTLPPLAAYLYPPKHWRYGEAACRLERFLFTCNLLGSVIFI
TCISLNRYLGIVHPFFARSHLRPKHAWAVSAAGWVLAALLAMPTLSFSHLKRPQQGAGNC
SVARPEACIKCLGTADHGLAAYRAYSLVLAGLGCGLPLLLTLAAYGALGRAVLRSPGMTV
AEKLRVAALVASGVALYASSYVPYHIMRVLNVDARRRWSTRCPSFADIAQATAALELGPY
VGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATA
APKPSEPQSRELSQ
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggcagccaacgtctcgggtgccaagtcctgccctgccaacttcttggcagctgccgac
gacaaactcagtgggttccagggggacttcctgtggcccatactggtggttgagttcctg
gtggccgtggccagcaatggcctggccctgtaccgcttcagcatccggaagcagcgccca
tggcaccccgccgtggtcttctctgtccagctggcagtcagcgacctgctctgcgccctg
acgctgcccccgctggccgcctacctctatccccccaagcactggcgctatggggaggcc
gcgtgccgcctggagcgcttcctcttcacctgcaacctgctgggcagcgtcatcttcatc
acctgcatcagcctcaaccgctacctgggcatcgtgcaccccttcttcgcccgaagccac
ctgcgacccaagcacgcctgggccgtgagcgctgccggctgggtcctggccgccctgctg
gccatgcccacactcagcttctcccacctgaagaggccgcagcagggggcgggcaactgc
agcgtggccaggcccgaggcctgcatcaagtgtctggggacagcagaccacgggctggcg
gcctacagagcgtatagcctggtgctggcggggttgggctgcggcctgccgctgctgctc
acgctggcagcctacggcgccctcgggcgggccgtgctacgcagcccaggcatgactgtg
gccgagaagctgcgtgtggcagcgttggtggccagtggtgtggccctctacgccagctcc
tatgtgccctaccacatcatgcgggtgctcaacgtggatgctcggcggcgctggagcacc
cgctgcccgagctttgcagacatagcccaggccacagcagccctggagctggggccctac
gtgggctaccaggtgatgcggggcctcatgcccctggccttctgtgtccaccctctactc
tacatggccgcagtgcccagcctgggctgctgctgccgacactgccccggctacagggac
agctggaacccagaggacgccaagagcactggccaagccctgcccctcaatgccacagcc
gcccctaaaccgtcagagccccagtcccgtgagctgagccaatga

KEGG   Homo sapiens (human): 53829
Entry
53829             CDS       T01001                                 

Gene name
P2RY13, FKSG77, GPCR1, GPR86, GPR94, P2Y13, SP174
Definition
(RefSeq) purinergic receptor P2Y13
  KO
K08388  P2Y purinoceptor 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    53829 (P2RY13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    53829 (P2RY13)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    53829 (P2RY13)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv DUF373
Other DBs
NCBI-GeneID: 53829
NCBI-ProteinID: NP_795713
OMIM: 606380
HGNC: 4537
Ensembl: ENSG00000181631
Vega: OTTHUMG00000155745
Pharos: Q9BPV8(Tchem)
UniProt: Q9BPV8
LinkDB
Position
3q25.1
AA seq 354 aa
MTAAIRRQRELSILPKVTLEAMNTTVMQGFNRSERCPRDTRIVQLVFPALYTVVFLTGIL
LNTLALWVFVHIPSSSTFIIYLKNTLVADLIMTLMLPFKILSDSHLAPWQLRAFVCRFSS
VIFYETMYVGIVLLGLIAFDRFLKIIRPLRNIFLKKPVFAKTVSIFIWFFLFFISLPNTI
LSNKEATPSSVKKCASLKGPLGLKWHQMVNNICQFIFWTVFILMLVFYVVIAKKVYDSYR
KSKSKDRKNNKKLEGKVFVVVAVFFVCFAPFHFARVPYTHSQTNNKTDCRLQNQLFIAKE
TTLFLAATNICMDPLIYIFLCKKFTEKLPCMQGRKTTASSQENHSSQTDNITLG
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgactgccgccataagaagacagagagaactgagtatcctcccaaaggtgacactggaa
gcaatgaacaccacagtgatgcaaggcttcaacagatctgagcggtgccccagagacact
cggatagtacagctggtattcccagccctctacacagtggttttcttgaccggcatcctg
ctgaatactttggctctgtgggtgtttgttcacatccccagctcctccaccttcatcatc
tacctcaaaaacactttggtggccgacttgataatgacactcatgcttcctttcaaaatc
ctctctgactcacacctggcaccctggcagctcagagcttttgtgtgtcgtttttcttcg
gtgatattttatgagaccatgtatgtgggcatcgtgctgttagggctcatagcctttgac
agattcctcaagatcatcagacctttgagaaatatttttctaaaaaaacctgtttttgca
aaaacggtctcaatcttcatctggttctttttgttcttcatctccctgccaaatacgatc
ttgagcaacaaggaagcaacaccatcgtctgtgaaaaagtgtgcttccttaaaggggcct
ctggggctgaaatggcatcaaatggtaaataacatatgccagtttattttctggactgtt
tttatcctaatgcttgtgttttatgtggttattgcaaaaaaagtatatgattcttataga
aagtccaaaagtaaggacagaaaaaacaacaaaaagctggaaggcaaagtatttgttgtc
gtggctgtcttctttgtgtgttttgctccatttcattttgccagagttccatatactcac
agtcaaaccaacaataagactgactgtagactgcaaaatcaactgtttattgctaaagaa
acaactctctttttggcagcaactaacatttgtatggatcccttaatatacatattctta
tgtaaaaaattcacagaaaagctaccatgtatgcaagggagaaagaccacagcatcaagc
caagaaaatcatagcagtcagacagacaacataaccttaggctga

KEGG   Homo sapiens (human): 9934
Entry
9934              CDS       T01001                                 

Gene name
P2RY14, BPR105, GPR105, P2Y14
Definition
(RefSeq) purinergic receptor P2Y14
  KO
K04299  P2Y purinoceptor 14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    9934 (P2RY14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    9934 (P2RY14)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    9934 (P2RY14)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx T4SS_pilin DUF948 DUF2615 DUF373
Other DBs
NCBI-GeneID: 9934
NCBI-ProteinID: NP_001074924
OMIM: 610116
HGNC: 16442
Ensembl: ENSG00000174944
Vega: OTTHUMG00000159859
Pharos: Q15391(Tbio)
UniProt: Q15391 A5JUU3
LinkDB
Position
3q25.1
AA seq 338 aa
MINSTSTQPPDESCSQNLLITQQIIPVLYCMVFIAGILLNGVSGWIFFYVPSSKSFIIYL
KNIVIADFVMSLTFPFKILGDSGLGPWQLNVFVCRVSAVLFYVNMYVSIVFFGLISFDRY
YKIVKPLWTSFIQSVSYSKLLSVIVWMLMLLLAVPNIILTNQSVREVTQIKCIELKSELG
RKWHKASNYIFVAIFWIVFLLLIVFYTAITKKIFKSHLKSSRNSTSVKKKSSRNIFSIVF
VFFVCFVPYHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQ
PFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgatcaattcaacctccacacagcctccagatgaatcctgctctcagaacctcctgatc
actcagcagatcattcctgtgctgtactgtatggtcttcattgcaggaatcctactcaat
ggagtgtcaggatggatattcttttacgtgcccagctctaagagtttcatcatctatctc
aagaacattgttattgctgactttgtgatgagcctgacttttcctttcaagatccttggt
gactcaggccttggtccctggcagctgaacgtgtttgtgtgcagggtctctgccgtgctc
ttctacgtcaacatgtacgtcagcattgtgttctttgggctcatcagctttgacagatat
tataaaattgtaaagcctctttggacttctttcatccagtcagtgagttacagcaaactt
ctgtcagtgatagtatggatgctcatgctcctccttgctgttccaaatattattctcacc
aaccagagtgttagggaggttacacaaataaaatgtatagaactgaaaagtgaactggga
cggaagtggcacaaagcatcaaactacatcttcgtggccatcttctggattgtgtttctt
ttgttaatcgttttctatactgctatcacaaagaaaatctttaagtcccaccttaagtca
agtcggaattccacttcggtcaaaaagaaatctagccgcaacatattcagcatcgtgttt
gtgttttttgtctgttttgtaccttaccatattgccagaatcccctacacaaagagtcag
accgaagctcattacagctgccagtcaaaagaaatcttgcggtatatgaaagaattcact
ctgctactatctgctgcaaatgtatgcttggaccctattatttatttctttctatgccag
ccgtttagggaaatcttatgtaagaaattgcacattccattaaaagctcagaatgaccta
gacatttccagaatcaaaagaggaaatacaacacttgaaagcacagatactttgtga

DBGET integrated database retrieval system