KEGG   Homo sapiens (human): 10163
Entry
10163             CDS       T01001                                 

Gene name
WASF2, IMD2, SCAR2, WASF4, WAVE2, dJ393P12.2
Definition
(RefSeq) WASP family member 2
  KO
K05748  WAS protein family, member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04520  Adherens junction
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05135  Yersinia infection
hsa05231  Choline metabolism in cancer
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01066  ARNO-ARF-ACTB_G signaling pathway
N01067  Shigella IpgD to ARNO-ARF-ACTB_G signaling pathway
N01086  Escherichia EspT to RAC signaling pathway
N01128  Salmonella SopE to RAC signaling pathway
N01129  Salmonella SopB to ARNO-ARF-ACTB/G signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    10163 (WASF2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10163 (WASF2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    10163 (WASF2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    10163 (WASF2)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10163 (WASF2)
   05131 Shigellosis
    10163 (WASF2)
   05135 Yersinia infection
    10163 (WASF2)
   05100 Bacterial invasion of epithelial cells
    10163 (WASF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10163 (WASF2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     10163 (WASF2)
SSDB
Motif
Pfam: WH2 WASH_WAHD RasGAP
Other DBs
NCBI-GeneID: 10163
NCBI-ProteinID: NP_008921
OMIM: 605875
HGNC: 12733
Ensembl: ENSG00000158195
Vega: OTTHUMG00000003393
Pharos: Q9Y6W5(Tbio)
UniProt: Q9Y6W5
LinkDB
Position
1p36.11
AA seq 498 aa
MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSKYAEDIFGELFTQANT
FASRVSSLAERVDRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPV
LETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIMKEKRKHRK
EKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKLGTSGYPPTLVYQNGSIGCVEN
VDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHP
PPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPD
FAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTGADGQPAIPPPL
SDTTKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVE
YSDSEDDSSEFDEDDWSD
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgccgttagtaacgaggaacatcgagccaaggcacctgtgccgtcagacgttgcctagc
gttagaagcgagctggaatgcgtgaccaacatcaccctggcaaatgtcatccgacagctg
ggcagcctgagtaaatatgcagaggacatttttggagagctctttactcaggcaaatacc
tttgcctctcgggtaagctcccttgctgagagggtcgaccgactacaggttaaagtcact
cagctggatcccaaggaagaagaagtgtcactgcaaggaatcaacacccgaaaagccttc
agaagttccaccattcaagaccagaagctttttgacagaaactctctcccagtgcctgtc
ttagaaacatacaatacctgtgatactcctccccctctcaacaatcttaccccttacagg
gacgatggaaaagaggcactcaaattctacacagacccttcatacttctttgatctttgg
aaggagaagatgctgcaggacaccaaggatatcatgaaagagaagagaaagcataggaaa
gaaaagaaagataatccaaatcgagggaatgtaaacccacgtaaaatcaagacacgtaag
gaagagtgggagaaaatgaagatggggcaagaatttgtggagtccaaagaaaagctgggg
acttctgggtatccacccactttggtgtaccagaatggcagcattggctgtgttgaaaac
gtggatgcaagtagctatccgccaccaccacagtcagactctgcttcttcaccttctcct
tccttctccgaggacaacttgcctcctccaccagcagaattcagttacccagtggacaac
caaagaggatctggtttggctggacccaaaagatccagtgtggtcagcccaagccatcca
ccaccagctcctcctctaggctctccaccaggccctaaacccgggtttgctccaccacct
gcccctccgccacctccgcctccaatgataggcatcccacctccaccaccgcctgtagga
tttgggtctccagggacgcctccaccaccctcacccccatctttcccacctcaccctgat
tttgctgcccctccacctcctcctccaccaccagcagctgactacccaactctgccacca
cctcccttgtcccagccaacaggaggagcacctcctcctccccctcctcctcctcctccg
gggccccctcctccccctttcactggtgcagatggccagcctgctataccaccaccgctt
tctgataccaccaagcccaagtcctccttgcctgccgtgagcgatgcccgtagcgacctg
ctttcagccatccgtcaaggttttcagctgcgcagggttgaggagcagcgggaacaagag
aagcgggatgttgtgggcaatgacgtggccaccatcttgtctcgtcgcattgctgttgag
tacagtgactcagaagatgactcctctgaatttgatgaggacgactggtccgattaa

KEGG   Homo sapiens (human): 8936
Entry
8936              CDS       T01001                                 

Gene name
WASF1, NEDALVS, SCAR1, WAVE, WAVE1
Definition
(RefSeq) WASP family member 1
  KO
K05753  WAS protein family, member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04520  Adherens junction
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05231  Choline metabolism in cancer
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01066  ARNO-ARF-ACTB_G signaling pathway
N01067  Shigella IpgD to ARNO-ARF-ACTB_G signaling pathway
N01128  Salmonella SopE to RAC signaling pathway
N01129  Salmonella SopB to ARNO-ARF-ACTB/G signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    8936 (WASF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    8936 (WASF1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    8936 (WASF1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    8936 (WASF1)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    8936 (WASF1)
   05131 Shigellosis
    8936 (WASF1)
   05100 Bacterial invasion of epithelial cells
    8936 (WASF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    8936 (WASF1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     8936 (WASF1)
SSDB
Motif
Pfam: WH2
Other DBs
NCBI-GeneID: 8936
NCBI-ProteinID: NP_001020105
OMIM: 605035
HGNC: 12732
Ensembl: ENSG00000112290
Vega: OTTHUMG00000015357
Pharos: Q92558(Tbio)
UniProt: Q92558
LinkDB
Structure
PDB: 
3P8C 4N78

Position
6q21
AA seq 559 aa
MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAH
SFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIP
LQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQK
QKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFETRPQ
TYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPIPTCISSA
TGLIENRPQSPATGRTPVFVSPTPPPPPPPLPSALSTSSLRASMTSTPPPPVPPPPPPPA
TALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEV
QGLPPPPPPPPLPPPGIRPSSPVTVTALAHPPSGLHPTPSTAPGPHVPLMPPSPPSQVIP
ASEPKRHPSTLPVISDARSVLLEAIRKGIQLRKVEEQREQEAKHERIENDVATILSRRIA
VEYSDSEDDSEFDEVDWLE
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgccgctagtgaaaagaaacatcgatcctaggcacttgtgccacacagcactgcctaga
ggcattaagaatgaactggaatgtgtaaccaatatttccttggcaaatataattagacaa
ctaagtagcctaagtaaatatgctgaagatatatttggagaattattcaatgaagcacat
agtttttccttcagagtcaactcattgcaagaacgtgtggaccgtttatctgttagtgtt
acacagcttgatccaaaggaagaagaattgtctttgcaagatataacaatgaggaaagct
ttccgaagttctacaattcaagaccagcagcttttcgatcgcaagactttgcctattcca
ttacaggagacgtacgatgtttgtgaacagcctccacctctcaatatactcactccttat
agagatgatggtaaagaaggtctgaagttttataccaatccttcgtatttctttgatcta
tggaaagaaaaaatgttgcaagatacagaggataagaggaaggaaaagaggaagcagaag
cagaaaaatctagatcgtcctcatgaaccagaaaaagtgccaagagcacctcatgacagg
cggcgagaatggcagaagctggcccaaggtccagagctggctgaagatgatgctaatctc
ttacataagcatattgaagttgctaatggcccagcctctcattttgaaacaagacctcag
acatacgtggatcatatggatggatcttactcactttctgccttgccatttagtcagatg
agtgagcttctgactagagctgaggaaagggtattagtcagaccacatgaaccacctcca
cctccaccaatgcatggagcaggagatgcaaaaccgatacccacctgtatcagttctgct
acaggtttgatagaaaatcgccctcagtcaccagctacaggcagaacacctgtgtttgtg
agccccactcccccacctcctccaccacctcttccatctgccttgtcaacttcctcatta
agagcttcaatgacttcaactcctccccctccagtacctcccccacctccacctccagcc
actgctttgcaagctccagcagtaccaccacctccagctcctcttcagattgcccctgga
gttcttcacccagctcctcctccaattgcacctcctctagtacagccctctccaccagta
gctagagctgccccagtatgtgagactgtaccagttcatccactcccacaaggtgaagtt
caggggctgcctccacccccaccaccgcctcctctgcctccacctggcattcgaccatca
tcacctgtcacagttacagctcttgctcatcctccctctgggctacatccaactccatct
actgccccaggtccccatgttccattaatgcctccatctcctccatcacaagttatacct
gcttctgagccaaagcgccatccatcaaccctacctgtaatcagtgatgccaggagtgtg
ctactggaagcaatacgaaaaggtattcagctacgcaaagtagaagagcagcgtgaacag
gaagctaagcatgaacgcattgaaaacgatgttgccaccatcctgtctcgccgtattgct
gttgaatatagtgattcggaagatgattcagaatttgatgaagtagattggttggagtaa

DBGET integrated database retrieval system