KEGG   Homo sapiens (human): 10170
Entry
10170             CDS       T01001                                 

Gene name
DHRS9, 3-alpha-HSD, 3ALPHA-HSD, RDH-E2, RDH-TBE, RDH15, RDHL, RDHTBE, RETSDR8, SDR9C4
Definition
(RefSeq) dehydrogenase/reductase 9
  KO
K11149  dehydrogenase/reductase SDR family member 9 [EC:1.1.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    10170 (DHRS9)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.-  Acting on the CH-OH group of donors
    1.1.-.-  
     10170 (DHRS9)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 10170
NCBI-ProteinID: NP_001135742
OMIM: 612131
HGNC: 16888
Ensembl: ENSG00000073737
Vega: OTTHUMG00000132180
Pharos: Q9BPW9(Tbio)
UniProt: Q9BPW9
LinkDB
Position
2q31.1
AA seq 319 aa
MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAAC
LTESGSTALKAETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLA
PTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSK
YAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGE
GYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAA
LQDFLLLKQKAELANPKAV
NT seq 960 nt   +upstreamnt  +downstreamnt
atgctcttttgggtgctaggcctcctaatcctctgtggttttctgtggactcgtaaagga
aaactaaagattgaagacatcactgataagtacatttttatcactggatgtgactcgggc
tttggaaacttggcagccagaacttttgataaaaagggatttcatgtaatcgctgcctgt
ctgactgaatcaggatcaacagctttaaaggcagaaacctcagagagacttcgtactgtg
cttctggatgtgaccgacccagagaatgtcaagaggactgcccagtgggtgaagaaccaa
gttggggagaaaggtctctggggtctgatcaataatgctggtgttcccggcgtgctggct
cccactgactggctgacactagaggactacagagaacctattgaagtgaacctgtttgga
ctcatcagtgtgacactaaatatgcttcctttggtcaagaaagctcaagggagagttatt
aatgtctccagtgttggaggtcgccttgcaatcgttggagggggctatactccatccaaa
tatgcagtggaaggtttcaatgacagcttaagacgggacatgaaagcttttggtgtgcac
gtctcatgcattgaaccaggattgttcaaaacaaacttggcagatccagtaaaggtaatt
gaaaaaaaactcgccatttgggagcagctgtctccagacatcaaacaacaatatggagaa
ggttacattgaaaaaagtctagacaaactgaaaggcaataaatcctatgtgaacatggac
ctctctccggtggtagagtgcatggaccacgctctaacaagtctcttccctaagactcat
tatgccgctggaaaagatgccaaaattttctggatacctctgtctcacatgccagcagct
ttgcaagactttttattgttgaaacagaaagcagagctggctaatcccaaggcagtgtga

KEGG   Homo sapiens (human): 10901
Entry
10901             CDS       T01001                                 

Gene name
DHRS4, CR, NRDR, PHCR, PSCD, SCAD-SRL, SDR-SRL, SDR25C1, SDR25C2
Definition
(RefSeq) dehydrogenase/reductase 4
  KO
K11147  dehydrogenase/reductase SDR family member 4 [EC:1.1.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    10901 (DHRS4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    10901 (DHRS4)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.-  Acting on the CH-OH group of donors
    1.1.-.-  
     10901 (DHRS4)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR DUF1776 F420_oxidored DFP YjeF_N DUF5037
Other DBs
NCBI-GeneID: 10901
NCBI-ProteinID: NP_066284
OMIM: 611596
HGNC: 16985
Ensembl: ENSG00000157326
Vega: OTTHUMG00000028777
Pharos: Q9BTZ2(Tbio)
UniProt: Q9BTZ2
LinkDB
Structure
PDB: 
3O4R

Position
14q11.2
AA seq 278 aa
MHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVV
VSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVN
PFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFS
PYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIR
RLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL
NT seq 837 nt   +upstreamnt  +downstreamnt
atgcacaaggcggggctgctaggcctctgtgcccgggcttggaattcggtgcggatggcc
agctccgggatgacccgccgggacccgctcgcaaataaggtggccctggtaacggcctcc
accgacgggatcggcttcgccatcgcccggcgtttggcccaggacggggcccatgtggtc
gtcagcagccggaagcagcagaatgtggaccaggcggtggccacgctgcagggggagggg
ctgagcgtgacgggcaccgtgtgccatgtggggaaggcggaggaccgggagcggctggtg
gccacggctgtgaagcttcatggaggtatcgatatcctagtctccaatgctgctgtcaac
cctttctttggaagcataatggatgtcactgaggaggtgtgggacaagactctggacatt
aatgtgaaggccccagccctgatgacaaaggcagtggtgccagaaatggagaaacgagga
ggcggctcagtggtgatcgtgtcttccatagcagccttcagtccatctcctggcttcagt
ccttacaatgtcagtaaaacagccttgctgggcctgaccaagaccctggccatagagctg
gccccaaggaacattagggtgaactgcctagcacctggacttatcaagactagcttcagc
aggatgctctggatggacaaggaaaaagaggaaagcatgaaagaaaccctgcggataaga
aggttaggcgagccagaggattgtgctggcatcgtgtctttcctgtgctctgaagatgcc
agctacatcactggggaaacagtggtggtgggtggaggaaccccgtcccgcctctga

KEGG   Homo sapiens (human): 317749
Entry
317749            CDS       T01001                                 

Gene name
DHRS4L2, SDR25C3
Definition
(RefSeq) dehydrogenase/reductase 4 like 2
  KO
K11148  dehydrogenase/reductase SDR family member 4-like protein 2 [EC:1.1.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    317749 (DHRS4L2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.-  Acting on the CH-OH group of donors
    1.1.-.-  
     317749 (DHRS4L2)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 317749
NCBI-ProteinID: NP_001180564
OMIM: 615196
HGNC: 19731
Ensembl: ENSG00000187630
Vega: OTTHUMG00000028778
UniProt: D5KJA1
LinkDB
Position
14q11.2
AA seq 170 aa
MPFPCLSLPSSWDYRIGFAIARRLAQDRAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVC
HVGKAEDRERLVAMTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPY
NVSKTALLGLNNTLAIELAPRNIRVNCLHLDLSRLASAGCSGWTRKKRKA
NT seq 513 nt   +upstreamnt  +downstreamnt
atgccattcccctgcctcagcctcccgagtagctgggactacaggatcggcttcgccatc
gcccggcgtttggcccaggacagggcccacgtggtcgtcagcagccggaagcagcagaat
gtggaccaggcggtggccacgctgcagggggaggggctgagcgtgacgggcactgtgtgc
catgtggggaaggcggaggaccgggagcggctggtggccatgactctggacattaatgtg
aaggccccagccctgatgacaaaggcagtggtgccagaaatggagaaacgaggaggcggc
tcagtggtgatcgtgtcttccatagcagccttcagtccatctcctggcttcagtccttac
aatgtcagtaaaacagccttgctgggcctcaacaataccctggccatagagctggcccca
aggaacattagggtgaactgcctgcacctggacttatcaagactagcttcagcaggatgc
tctggatggacaaggaaaaagaggaaagcatga

KEGG   Homo sapiens (human): 728635
Entry
728635            CDS       T01001                                 

Gene name
DHRS4L1, SDR25C4
Definition
(RefSeq) dehydrogenase/reductase 4 like 1
  KO
K11147  dehydrogenase/reductase SDR family member 4 [EC:1.1.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    728635 (DHRS4L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    728635 (DHRS4L1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.-  Acting on the CH-OH group of donors
    1.1.-.-  
     728635 (DHRS4L1)
SSDB
Motif
Pfam: adh_short_C2 adh_short
Other DBs
NCBI-GeneID: 728635
NCBI-ProteinID: NP_001264793
OMIM: 615195
HGNC: 19732
LinkDB
Position
14q11.2
AA seq 150 aa
MTGTVCHVGKMKDWERLVATVSCREMGTEPGGGKGSQPEPPSLLSWTALGFSPYNVSKTA
LLGLNKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDS
LGIVSFLCSEDASYLTGETVMVGGGTPSRL
NT seq 453 nt   +upstreamnt  +downstreamnt
atgacgggcactgtgtgccatgtggggaagatgaaggactgggagcggctggtggccaca
gtgagctgcagggaaatgggcacagagccaggaggtggaaaagggagccagcctgagcct
ccttccctgctttcctggacagcattgggcttcagtccttacaatgtcagtaaaacagcc
ttgctgggcctcaacaagaccttggccatagagctggccccaaggaacattagggtgaac
tgcctagcacctggacttatcaagactagcttcagcaggatgctctggatggacaaggaa
aaagaggaaagcatgaaagaaaccctgcggataagaaggttaggcgagccagaggattct
cttggcatcgtgtctttcctgtgctctgaagatgccagctacctcactggggaaacagtg
atggtgggtggaggaaccccgtcccgcctctga

KEGG   Homo sapiens (human): 9249
Entry
9249              CDS       T01001                                 

Gene name
DHRS3, DD83.1, RDH17, Rsdr1, SDR1, SDR16C1, retSDR1
Definition
(RefSeq) dehydrogenase/reductase 3
  KO
K11146  short-chain dehydrogenase/reductase 3 [EC:1.1.1.300]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    9249 (DHRS3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.300  NADP-retinol dehydrogenase
     9249 (DHRS3)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Polysacc_synt_2 Shikimate_DH Epimerase Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 9249
NCBI-ProteinID: NP_004744
OMIM: 612830
HGNC: 17693
Ensembl: ENSG00000162496
Vega: OTTHUMG00000001885
Pharos: O75911(Tbio)
UniProt: O75911
LinkDB
Position
1p36.21
AA seq 302 aa
MVWKRLGALVMFPLQMIYLVVKAAVGLVLPAKLRDLSRENVLITGGGRGIGRQLAREFAE
RGARKIVLWGRTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITIL
VNNAAVVHGKSLMDSDDDALLKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALS
AIPGAIDYCTSKASAFAFMESLTLGLLDCPGVSATTVLPFHTSTEMFQGMRVRFPNLFPP
LKPETVARRTVEAVQLNQALLLLPWTMHALVILKSILPQAALEEIHKFSGTYTCMNTFKG
RT
NT seq 909 nt   +upstreamnt  +downstreamnt
atggtgtggaaacggctgggcgcgctggtgatgttccctctacagatgatctatctggtg
gtgaaagcagccgtcggactggtgctgcccgccaagctgcgggacctgtcgcgggagaac
gtcctcatcaccggcggcgggagaggcatcgggcgtcagctcgcccgcgagttcgcggag
cgcggcgccagaaagattgttctctggggccggactgagaaatgcctgaaggagacgacg
gaggagatccggcagatgggcactgagtgccattacttcatctgtgatgtgggcaaccgg
gaggaggtgtaccagacggccaaggccgtccgggagaaggtgggtgacatcaccatcctg
gtgaacaatgccgccgtggtccatgggaagagcctaatggacagtgatgatgatgccctc
ctcaagtcccaacacatcaacaccctgggccagttctggaccaccaaggccttcctgccg
cgtatgctggagctgcagaatggccacatcgtgtgcctcaactccgtgctggcactgtct
gccatccccggtgccatcgactactgcacatccaaagcgtcagccttcgccttcatggag
agcctgaccctggggctgctggactgtccgggagtcagcgccaccacagtgctgcccttc
cacaccagcaccgagatgttccagggcatgagagtcaggtttcccaacctctttccccca
ctgaagccggagacggtggcccggaggacagtggaagctgtgcagctcaaccaggccctc
ctcctcctcccatggacaatgcatgccctcgttatcttgaaaagcatacttccacaggct
gcactcgaggagatccacaaattctcaggaacctacacctgcatgaacactttcaaaggg
cggacatag

DBGET integrated database retrieval system