KEGG   Homo sapiens (human): 10189Help
Entry
10189             CDS       T01001                                 

Gene name
ALYREF, ALY, ALY/REF, BEF, REF, THOC4
Definition
(RefSeq) Aly/REF export factor
  KO
K12881  THO complex subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa03015  mRNA surveillance pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    10189 (ALYREF)
  09122 Translation
   03013 RNA transport
    10189 (ALYREF)
   03015 mRNA surveillance pathway
    10189 (ALYREF)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    10189 (ALYREF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    10189 (ALYREF)
   03041 Spliceosome [BR:hsa03041]
    10189 (ALYREF)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     10189 (ALYREF)
    TREX complex
     10189 (ALYREF)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   EJC/TREX
    10189 (ALYREF)
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    10189 (ALYREF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 FoP_duplication FYTT
Motif
Other DBs
NCBI-GeneID: 10189
NCBI-ProteinID: NP_005773
OMIM: 604171
HGNC: 19071
Ensembl: ENSG00000183684
Vega: OTTHUMG00000160470
Pharos: Q86V81(Tbio)
UniProt: Q86V81 E9PB61
LinkDB All DBs
Structure
PDB: 

Position
17q25.3
AA seq 264 aa AA seqDB search
MPDSAPAMADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGG
PIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNL
DFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDG
RPMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFGGGGGTRRGTRGGARGRGRGAGRN
SKQQLSAEELDAQLDAYNARMDTS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgcccgattccgcgcccgccatggccgacaaaatggacatgtctctggacgacatcatt
aaactgaaccggagccagcgaggcggccggggcgggggccggggccgcggccgggccggc
tcccagggcggccgcggcggtggggcgcaggccgccgcgcgagtgaatcgaggcggcggg
cccatccggaaccggccggccatcgcccgcggcgcggccggcggaggcggcaggaaccga
ccggcgccctacagcaggccaaaacaacttcccgacaagtggcagcacgatcttttcgac
agtggcttcggcggtggtgccggcgtggagacaggtgggaaactgctggtgtccaatctg
gattttggagtctcagacgccgatattcaggaactctttgctgaatttggaacgctgaag
aaggcggctgtgcactatgatcgctctggtcgcagcttaggaacagcagacgtgcacttt
gagcggaaggcagatgccctgaaggccatgaagcagtacaacggcgtccctctggatggc
cgccccatgaacattcagcttgtcacgtcacagattgacgcacagcggaggcctgcacag
agcgtaaacagaggtggcatgactagaaaccgtggcgctggaggttttggtggtggtgga
ggcacccggagaggcacccgcggaggcgcccgtggaagaggcagaggtgccggcaggaat
tcaaagcagcagctttcggcagaggagctggatgcccagctggacgcctataatgcgaga
atggacaccagttaa

DBGET integrated database retrieval system