KEGG   Homo sapiens (human): 101929773
Entry
101929773         CDS       T01001                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B10-like
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C
Other DBs
NCBI-GeneID: 101929773
NCBI-ProteinID: XP_005275697
LinkDB
Position
4
AA seq 195 aa
VLWRFDGNKPDALGLNTRLYRWIPQNDLLGHPKTRAFITHGGANGIYETIYHGIPMVGIP
LFFDQSDNIAHMKAKGTAVRVDFNTMSSTDLLNALKTVINDPSYKENIMKSSRIHHDQPV
KPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVIGFLLACVATVLFIITKCCLF
CFWKFARKGKKGKRD
NT seq 588 nt   +upstreamnt  +downstreamnt
gttctttggagatttgatgggaataaaccagatgccttaggtctcaatactcggctgtac
aggtggataccccagaatgaccttctaggtcatccaaaaaccagagcttttataactcat
ggtggagccaatggcatctacgagacaatctaccatgggatccctatggtgggcattcca
ttgttttttgatcaatctgataacattgctcacatgaaggccaagggaacagctgttaga
gtggacttcaacacaatgtcgagtacagacctgctgaatgcactgaagacagtaattaat
gatccttcatataaagagaatattatgaaatcatcaagaattcatcatgatcaaccagtg
aagcccttggatcgagcagtcttctggattgaatttgtcatgcgccacaaaggagccaaa
caccttcgagttgcagcccatgacctcacctggttccagtaccactctttggatgtgatt
gggttcctgctggcctgtgtggcaactgtgctatttatcatcacaaagtgttgtctgttt
tgtttctggaagttcgctagaaaaggaaagaaaggaaaaagggattag

DBGET integrated database retrieval system