KEGG   Homo sapiens (human): 10193Help
Entry
10193             CDS       T01001                                 

Gene name
RNF41, FLRF, NRDP1, SBBI03
Definition
(RefSeq) ring finger protein 41
  KO
K11981  E3 ubiquitin-protein ligase NRDP1 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    10193 (RNF41)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10193 (RNF41)
   04121 Ubiquitin system [BR:hsa04121]
    10193 (RNF41)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    10193 (RNF41)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     10193 (RNF41)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    10193 (RNF41)
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    10193 (RNF41)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    10193 (RNF41)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    10193 (RNF41)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: USP8_interact zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_4 zf-RING_6 zf-RING_UBOX Sina zf-rbx1 zf-C3HC4_3 zf-Nse zf-RING_5 U-box zf-ANAPC11 Trimer_CC zf-RING_10 Zn_ribbon_17 BLOC1_2 zf-TRAF PI3K_P85_iSH2 SlyX DUF641 Prok-RING_4 zf-TRAF_2
Motif
Other DBs
NCBI-GeneID: 10193
NCBI-ProteinID: NP_001229755
HGNC: 18401
Ensembl: ENSG00000181852
Vega: OTTHUMG00000170328
Pharos: Q9H4P4(Tbio)
UniProt: Q9H4P4 A0A024RB33
LinkDB All DBs
Structure
PDB: 

Position
12q13.3
AA seq 317 aa AA seqDB search
MGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWFSQQQTCPVDRSVV
TVAHLRPVPRIMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGC
GLEMPKDELPNHNCIKHLRSVVQQQQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAI
RSVNPNLQNLEETIEYNEILEWVNSLQPARVTRWGGMISTPDAVLQAVIKRSLVESGCPA
SIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRIPGKQAVVVMACENQHMGDDM
VQEPGLVMIFAHGVEEI
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggggtatgatgtaacccgtttccagggggatgttgacgaagatcttatctgccctatt
tgcagtggagtcttggaggagccagtacaggcacctcattgtgaacatgctttctgcaac
gcctgcatcacccagtggttctctcagcaacagacatgtccagtggaccgtagtgttgtg
acggtcgcccatctgcgcccagtacctcggatcatgcggaacatgttgtcaaagctgcag
attgcctgtgacaacgctgtgttcggctgtagtgccgttgtccggcttgacaacctcatg
tctcacctcagcgactgtgagcacaacccgaagcggcctgtgacctgtgaacagggctgt
ggcctggagatgcccaaagatgagctgcccaaccataactgcattaagcacctgcgctca
gtggtacagcagcagcagacacgcatcgcagagctggagaagacgtcagctgaacacaaa
caccagctggcggagcagaagcgagacatccagctgctaaaggcatacatgcgtgcaatc
cgcagtgtcaaccccaaccttcagaacctggaggagacaattgaatacaacgagatccta
gagtgggtgaactcccttcagccagcaagagtgacccgctggggagggatgatctcgact
cctgatgctgtgctccaggctgtaatcaagcgctccctggtggagagtggctgtcctgct
tctattgtcaacgagctgattgaaaatgcccacgagcgtagctggccccagggtctggcc
acactagagactagacagatgaaccgacgctactatgagaactacgtggccaagcgcatc
cctggcaagcaggctgttgtcgtgatggcctgtgagaaccagcacatgggggatgacatg
gtgcaagagccaggccttgtcatgatatttgcgcatggcgtggaagagatataa

KEGG   Homo sapiens (human): 11059Help
Entry
11059             CDS       T01001                                 

Gene name
WWP1, AIP5, Tiul1, hSDRP1
Definition
(RefSeq) WW domain containing E3 ubiquitin protein ligase 1
  KO
K05633  NEDD4-like E3 ubiquitin-protein ligase WWP1 [EC:2.3.2.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    11059 (WWP1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    11059 (WWP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    11059 (WWP1)
   04121 Ubiquitin system [BR:hsa04121]
    11059 (WWP1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     11059 (WWP1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    11059 (WWP1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   11059 (WWP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HECT WW C2
Motif
Other DBs
NCBI-GeneID: 11059
NCBI-ProteinID: NP_008944
OMIM: 602307
HGNC: 17004
Ensembl: ENSG00000123124
Vega: OTTHUMG00000163690
Pharos: Q9H0M0(Tbio)
UniProt: Q9H0M0
LinkDB All DBs
Structure
PDB: 

Position
8q21.3
AA seq 922 aa AA seqDB search
MATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEITKTAKSSSSS
NPKWDEQLTVNVTPQTTLEFQVWSHRTLKADALLGKATIDLKQALLIHNRKLERVKEQLK
LSLENKNGIAQTGELTVVLDGLVIEQENITNCSSSPTIEIQENGDALHENGEPSARTTAR
LAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADD
TVNGESSSFAPTDNASVTGTPVVSEENALSPNCTSTTVEDPPVQEILTSSENNECIPSTS
AELESEARSILEPDTSNSRSSSAFEAAKSRQPDGCMDPVRQQSGNANTETLPSGWEQRKD
PHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRRRVYYVDHNTRTTTWQRPTMESVRNF
EQWQSQRNQLQGAMQQFNQRYLYSASMLAAENDPYGPLPPGWEKRVDSTDRVYFVNHNTK
TTQWEDPRTQGLQNEEPLPEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKSSVTKGGPQ
IAYERGFRWKLAHFRYLCQSNALPSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYVIF
RGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASTINPDHLSYFCFI
GRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESIDTEFYNSLIWIRDNNIEECGL
EMYFSVDMEILGKVTSHDLKLGGSNILVTEENKDEYIGLMTEWRFSRGVQEQTKAFLDGF
NEVVPLQWLQYFDEKELEVMLCGMQEVDLADWQRNTVYRHYTRNSKQIIWFWQFVKETDN
EVRMRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYK
SYEQLKEKLLFAIEETEGFGQE
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atggccactgcttcaccaaggtctgatactagtaataaccacagtggaaggttgcagtta
caggtaactgtttctagtgccaaacttaaaagaaaaaagaactggttcggaacagcaata
tatacagaagtagttgtagatggagaaattacgaaaacagcaaaatccagtagttcttct
aatccaaaatgggatgaacagctaactgtaaatgttacgccacagactacattggaattt
caagtttggagccatcgcactttaaaagcagatgctttattaggaaaagcaacgatagat
ttgaaacaagctctgttgatacacaatagaaaattggaaagagtgaaagaacaattaaaa
ctttccttggaaaacaagaatggcatagcacaaactggtgaattgacagttgtgcttgat
ggattggtgattgagcaagaaaatataacaaactgcagctcatctccaaccatagaaata
caggaaaatggtgatgccttacatgaaaatggagagccttcagcaaggacaactgccagg
ttggctgttgaaggcacgaatggaatagataatcatgtacctacaagcactctagtccaa
aactcatgctgctcgtatgtagttaatggagacaacacaccttcatctccgtctcaggtt
gctgccagacccaaaaatacaccagctccaaaaccactcgcatctgagcctgccgatgac
actgttaatggagaatcatcctcatttgcaccaactgataatgcgtctgtcacgggtact
ccagtagtgtctgaagaaaatgccttgtctccaaattgcactagtactactgttgaagat
cctccagttcaagaaatactgacttcctcagaaaacaatgaatgtattccttctaccagt
gcagaattggaatctgaagctagaagtatattagagcctgacacctctaattctagaagt
agttctgcttttgaagcagccaaatcaagacagccagatgggtgtatggatcctgtacgg
cagcagtctgggaatgccaacacagaaaccttgccatcagggtgggaacaaagaaaagat
cctcatggtagaacctattatgtggatcataatactcgaactaccacatgggagagacca
caacctttacctccaggttgggaaagaagagttgatgatcgtagaagagtttattatgtg
gatcataacaccagaacaacaacgtggcagcggcctaccatggaatctgtccgaaatttt
gaacagtggcaatctcagcggaaccaattgcagggagctatgcaacagtttaaccaacga
tacctctattcggcttcaatgttagctgcagaaaatgacccttatggacctttgccacca
ggctgggaaaaaagagtggattcaacagacagggtttactttgtgaatcataacacaaaa
acaacccagtgggaagatccaagaactcaaggcttacagaatgaagaacccctgccagaa
ggctgggaaattagatatactcgtgaaggtgtaaggtactttgttgatcataacacaaga
acaacaacattcaaagatcctcgcaatgggaagtcatctgtaactaaaggtggtccacaa
attgcttatgaacgcggctttaggtggaagcttgctcacttccgttatttgtgccagtct
aatgcactacctagtcatgtaaagatcaatgtgtcccggcagacattgtttgaagattcc
ttccaacagattatggcattaaaaccctatgacttgaggaggcgcttatatgtaatattt
agaggagaagaaggacttgattatggtggcctagcgagagaatggtttttcttgctttca
catgaagttttgaacccaatgtattgcttatttgagtatgcgggcaagaacaactattgt
ctgcagataaatccagcatcaaccattaatccagaccatctttcatacttctgtttcatt
ggtcgttttattgccatggcactatttcatggaaagtttatcgatactggtttctcttta
ccattctacaagcgtatgttaagtaaaaaacttactattaaggatttggaatctattgat
actgaattttataactcccttatctggataagagataacaacattgaagaatgtggctta
gaaatgtacttttctgttgacatggagattttgggaaaagttacttcacatgacctgaag
ttgggaggttccaatattctggtgactgaggagaacaaagatgaatatattggtttaatg
acagaatggcgtttttctcgaggagtacaagaacagaccaaagctttccttgatggtttt
aatgaagttgttcctcttcagtggctacagtacttcgatgaaaaagaattagaggttatg
ttgtgtggcatgcaggaggttgacttggcagattggcagagaaatactgtttatcgacat
tatacaagaaacagcaagcaaatcatttggttttggcagtttgtgaaagagacagacaat
gaagtaagaatgcgactattgcagttcgtcactggaacctgccgtttacctctaggagga
tttgctgagctcatgggaagtaatgggcctcaaaagttttgcattgaaaaagttggcaaa
gacacttggttaccaagaagccatacatgttttaatcgcttggatctaccaccatataag
agttatgaacaactaaaggaaaaacttctttttgcaatagaagagacagagggatttgga
caagaatga

KEGG   Homo sapiens (human): 23327Help
Entry
23327             CDS       T01001                                 

Gene name
NEDD4L, NEDD4-2, NEDD4.2, PVNH7, RSP5, hNEDD4-2
Definition
(RefSeq) NEDD4 like E3 ubiquitin protein ligase
  KO
K13305  E3 ubiquitin-protein ligase NEDD4-like [EC:2.3.2.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04144  Endocytosis
hsa04530  Tight junction
hsa04960  Aldosterone-regulated sodium reabsorption
Disease
H00270  Periventricular nodular heterotopia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    23327 (NEDD4L)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    23327 (NEDD4L)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    23327 (NEDD4L)
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    23327 (NEDD4L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23327 (NEDD4L)
   04121 Ubiquitin system [BR:hsa04121]
    23327 (NEDD4L)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     23327 (NEDD4L)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    23327 (NEDD4L)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   23327 (NEDD4L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HECT WW C2
Motif
Other DBs
NCBI-GeneID: 23327
NCBI-ProteinID: NP_001138439
OMIM: 606384
HGNC: 7728
Ensembl: ENSG00000049759
Vega: OTTHUMG00000179875
Pharos: Q96PU5(Tbio)
UniProt: Q96PU5
LinkDB All DBs
Structure
PDB: 

Position
18q21.31
AA seq 975 aa AA seqDB search
MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELAL
VQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPTEDP
TMERPYTFKDFLLRPRSHKSRVKGFLRLKMAYMPKNGGQDEENSDQRDDMEHGWEVVDSN
DSASQHQEELPPPPLPPGWEEKVDNLGRTYYVNHNNRTTQWHRPSLMDVSSESDNNIRQI
NQEAAHRRFRSRRHISEDLEPEPSEGGDVPEPWETISEEVNIAGDSLGLALPPPPASPGS
RTSPQELSEELSRRLQITPDSNGEQFSSLIQREPSSRLRSCSVTDAVAEQGHLPPPSAPA
GRARSSTVTGGEEPTPSVAYVHTTPGLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIMQL
AEDGASGSATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGAKDSPVRRAVKDTLSNPQSP
QPSPYNSPKPQHKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVHMRSKT
SLNPNDLGPLPPGWEERIHLDGRTFYIDHNSKITQWEDPRLQNPAITGPAVPYSREFKQK
YDYFRKKLKKPADIPNRFEMKLHRNNIFEESYRRIMSVKRPDVLKARLWIEFESEKGLDY
GGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLA
VFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTELDLMFCIDEE
NFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLI
KIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQ
FVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREK
LLMAVENAQGFEGVD
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgggctcggggagccggtctatggactttccgaagacgagggagagtcccgt
attctcagagtaaaagttgtttctggaattgatctcgccaaaaaggacatctttggagcc
agtgatccgtatgtgaaactttcattgtacgtagcggatgagaatagagaacttgctttg
gtccagacaaaaacaattaaaaagacactgaacccaaaatggaatgaagaattttatttc
agggtaaacccatctaatcacagactcctatttgaagtatttgacgaaaatagactgaca
cgagacgacttcctgggccaggtggacgtgccccttagtcaccttccgacagaagatcca
accatggagcgaccctatacatttaaggactttctcctcagaccaagaagtcataagtct
cgagttaagggatttttgcgattgaaaatggcctatatgccaaaaaatggaggtcaagat
gaagaaaacagtgaccagagggatgacatggagcatggatgggaagttgttgactcaaat
gactcggcttctcagcaccaagaggaacttcctcctcctcctctgcctcccgggtgggaa
gaaaaagtggacaatttaggccgaacttactatgtcaaccacaacaaccggaccactcag
tggcacagaccaagcctgatggacgtgtcctcggagtcggacaataacatcagacagatc
aaccaggaggcagcacaccggcgcttccgctcccgcaggcacatcagcgaagacttggag
cccgagccctcggagggcggggatgtccccgagccttgggagaccatttcagaggaagtg
aatatcgctggagactctctcggtctggctctgcccccaccaccggcctccccaggatct
cggaccagccctcaggagctgtcagaggaactaagcagaaggcttcagatcactccagac
tccaatggggaacagttcagctctttgattcaaagagaaccctcctcaaggttgaggtca
tgcagtgtcaccgacgcagttgcagaacagggccatctaccaccgcccagtgccccagct
gggagagcgcgttcatcaactgtcacgggtggtgaggaaccaacgccatcagtggcctat
gtacataccacgccgggtctgccttcaggctgggaagaaagaaaagatgctaaggggcgc
acatactatgtcaatcataacaatcgaaccacaacttggactcgacctatcatgcagctt
gcagaagatggtgcgtccggatcagccacaaacagtaacaaccatctaatcgagcctcag
atccgccggcctcgtagcctcagctcgccaacagtaactttatctgccccgctggagggt
gccaaggactcacccgtacgtcgggctgtgaaagacaccctttccaacccacagtcccca
cagccatcaccttacaactcccccaaaccacaacacaaagtcacacagagcttcttgcca
cccggctgggaaatgaggatagcgccaaacggccggcccttcttcattgatcataacaca
aagactacaacctgggaagatccacgtttgaaatttccagtacatatgcggtcaaagaca
tctttaaaccccaatgaccttggcccccttcctcctggctgggaagaaagaattcacttg
gatggccgaacgttttatattgatcataatagcaaaattactcagtgggaagacccaaga
ctgcagaacccagctattactggtccggctgtcccttactccagagaatttaagcagaaa
tatgactacttcaggaagaaattaaagaaacctgctgatatccccaataggtttgaaatg
aaacttcacagaaataacatatttgaagagtcctatcggagaattatgtccgtgaaaaga
ccagatgtcctaaaagctagactgtggattgagtttgaatcagagaaaggtcttgactat
gggggtgtggccagagaatggttcttcttactgtccaaagagatgttcaacccctactac
ggcctctttgagtactctgccacggacaactacacccttcagatcaaccctaattcaggc
ctctgtaatgaggatcatttgtcctacttcacttttattggaagagttgctggtctggcc
gtatttcatgggaagctcttagatggtttcttcattagaccattttacaagatgatgttg
ggaaagcagataaccctgaatgacatggaatctgtggatagtgaatattacaactctttg
aaatggatcctggagaatgaccctactgagctggacctcatgttctgcatagacgaagaa
aactttggacagacatatcaagtggatttgaagcccaatgggtcagaaataatggtcaca
aatgaaaacaaaagggaatatatcgacttagtcatccagtggagatttgtgaacagggtc
cagaagcagatgaacgccttcttggagggattcacagaactacttcctattgatttgatt
aaaatttttgatgaaaatgagctggagttgctcatgtgcggcctcggtgatgtggatgtg
aatgactggagacagcattctatttacaagaacggctactgcccaaaccaccccgtcatt
cagtggttctggaaggctgtgctactcatggacgccgaaaagcgtatccggttactgcag
tttgtcacagggacatcgcgagtacctatgaatggatttgccgaactttatggttccaat
ggtcctcagctgtttacaatagagcaatggggcagtcctgagaaactgcccagagctcac
acatgctttaatcgccttgacttacctccatatgaaacctttgaagatttacgagagaaa
cttctcatggccgtggaaaatgctcaaggatttgaaggggtggattaa

KEGG   Homo sapiens (human): 23624Help
Entry
23624             CDS       T01001                                 

Gene name
CBLC, CBL-3, CBL-SL, RNF57
Definition
(RefSeq) Cbl proto-oncogene C
  KO
K22518  E3 ubiquitin-protein ligase CBL-C [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    23624 (CBLC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    23624 (CBLC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23624 (CBLC)
   04121 Ubiquitin system [BR:hsa04121]
    23624 (CBLC)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     23624 (CBLC)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    23624 (CBLC)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    23624 (CBLC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cbl_N3 Cbl_N Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX SH2 zf-RING_5
Motif
Other DBs
NCBI-GeneID: 23624
NCBI-ProteinID: NP_036248
OMIM: 608453
HGNC: 15961
Ensembl: ENSG00000142273
Vega: OTTHUMG00000150715
Pharos: Q9ULV8(Tbio)
UniProt: Q9ULV8
LinkDB All DBs
Structure
PDB: 

Position
19q13.32
AA seq 474 aa AA seqDB search
MALAVAPWGRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAH
SRRAAGGGGPGGPGGSGDFLLIYLANLEAKSRQVAALLPPRGRRSANDELFRAGSRLRRQ
LAKLAIIFSHMHAELHALFPGGKYCGHMYQLTKAPAHTFWRESCGARCVLPWAEFESLLG
TCHPVEPGCTALALRTTIDLTCSGHVSIFEFDVFTRLFQPWPTLLKNWQLLAVNHPGYMA
FLTYDEVQERLQACRDKPGSYIFRPSCTRLGQWAIGYVSSDGSILQTIPANKPLSQVLLE
GQKDGFYLYPDGKTHNPDLTELGQAEPQQRIHVSEEQLQLYWAMDSTFELCKICAESNKD
VKIEPCGHLLCSCCLAAWQHSDSQTCPFCRCEIKGWEAVSIYQFHGQATAEDSGNSSDQE
GRELELGQVPLSAPPLPPRPDLPPRKPRNAQPKVRLLKGNSPPAALGPQDPAPA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggctctggcggtggccccgtgggggcgacagtgggaagaggcccgcgccctgggccgg
gcagtcaggatgctgcagcgcctagaagagcaatgcgtcgacccccggctgtccgtgagt
cccccttcgctgcgggacctgctgccccgcacagcgcagctgcttcgagaggtggcccat
tctcggcgggcggccggcggaggcggccccgggggtcccggcggctctggggactttcta
ctcatctacctggccaatctggaggccaagagcaggcaggtggccgcgctgctgcctccc
cggggccgaaggagtgccaacgacgagctcttccgggcgggctccagactcaggcgacag
ctggccaagctggccatcatcttcagccacatgcacgcagagctgcacgcactcttcccc
gggggaaagtactgtggacacatgtaccagctcaccaaggcccccgcccacaccttctgg
agggaaagttgcggagcccggtgtgtgctgccctgggctgagtttgagtccctcctgggc
acctgccaccctgtggaaccaggctgcacagccctggccttgcgcaccaccattgacctc
acctgcagcgggcacgtgtccatcttcgagttcgacgtcttcaccaggctctttcagcca
tggccaacactcctcaagaactggcagctcctggcagtcaaccacccaggctacatggcc
ttcctcacctatgatgaggtccaagagcgtctgcaggcctgcagggacaagccaggcagt
tacatcttccggcccagctgtactcgcctggggcagtgggccatcggctatgtgagctca
gatggcagcatcctgcagaccatccctgccaacaaacccctgtcccaggtgctcctggag
ggacagaaggacggcttctacctctacccagatggaaagacccacaacccagacctgact
gagctcggccaggcagaaccccagcagcgcatccacgtgtcagaggagcagctgcagctc
tactgggccatggactccacatttgagctctgcaagatctgtgctgagagcaacaaggat
gtgaagattgagccgtgcgggcacctgctctgcagctgctgcctggctgcctggcagcac
tcggacagccagacctgccccttctgccgctgcgagatcaagggctgggaggccgtgagt
atctaccagttccacggtcaggctactgctgaggactcagggaacagcagtgaccaggaa
ggcagggagttggagctggggcaggtgcccctttcggctcctccattgcccccacggcca
gatctgccccccaggaagcccagaaatgcccagccgaaagtgagactcctaaaggggaac
tcccctccagctgcgctgggaccccaggaccctgccccggcctga

KEGG   Homo sapiens (human): 4193Help
Entry
4193              CDS       T01001                                 

Gene name
MDM2, ACTFS, HDMX, hdm2
Definition
(RefSeq) MDM2 proto-oncogene
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa01524  Platinum drug resistance
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04115  p53 signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04144  Endocytosis
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa04625  C-type lectin receptor signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05219  Bladder cancer
hsa05220  Chronic myeloid leukemia
Network
nt06130  Cell cycle (virus)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06170  Influenza A virus (IAV)
nt06230  Cell cycle G1/S
nt06240  Transcription
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06268  Melanoma
nt06270  Breast cancer
nt06273  Glioma
nt06276  Chronic myeloid leukemia
  Element
N00066  MDM2-p21-Cell cycle G1/S
N00067  Deleted p14(ARF) to p21-cell cycle G1/S
N00068  Amplified MDM2 to p21-cell cycle G1/S
N00076  Mutation-inactivated p14(ARF) to p21-cell cycle G1/S
N00131  Amplified MYCN to transcriptional activation
N00263  EBV EBNA3C to p53-mediated transcription
N00496  MDM2-p21-Cell cycle G1/S
N00536  MDM2-p21-Cell cycle G1/S
Disease
H00025  Penile cancer
H00028  Choriocarcinoma
H00036  Osteosarcoma
H00037  Rhabdomyosarcoma
H00042  Glioma
H01513  Retinoblastoma
H01667  Medulloblastoma
Drug target
Idasanutlin: D11219
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4193 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    4193 (MDM2)
   04151 PI3K-Akt signaling pathway
    4193 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4193 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    4193 (MDM2)
   04115 p53 signaling pathway
    4193 (MDM2)
   04218 Cellular senescence
    4193 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    4193 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    4193 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4193 (MDM2)
   05202 Transcriptional misregulation in cancer
    4193 (MDM2)
   05206 MicroRNAs in cancer
    4193 (MDM2)
   05205 Proteoglycans in cancer
    4193 (MDM2)
   05203 Viral carcinogenesis
    4193 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    4193 (MDM2)
   05220 Chronic myeloid leukemia
    4193 (MDM2)
   05218 Melanoma
    4193 (MDM2)
   05219 Bladder cancer
    4193 (MDM2)
   05215 Prostate cancer
    4193 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    4193 (MDM2)
   05169 Epstein-Barr virus infection
    4193 (MDM2)
   05165 Human papillomavirus infection
    4193 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    4193 (MDM2)
   01522 Endocrine resistance
    4193 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4193 (MDM2)
   04121 Ubiquitin system [BR:hsa04121]
    4193 (MDM2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     4193 (MDM2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    4193 (MDM2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    4193 (MDM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_3 zf-RanBP SWIB zf-RING_2 Pinin_SDK_N zf-FPG_IleRS zinc_ribbon_2
Motif
Other DBs
NCBI-GeneID: 4193
NCBI-ProteinID: NP_002383
OMIM: 164785
HGNC: 6973
Ensembl: ENSG00000135679
Vega: OTTHUMG00000142827
Pharos: Q00987(Tchem)
UniProt: Q00987
LinkDB All DBs
Structure
PDB: 

Position
12q15
AA seq 497 aa AA seqDB search
MVRSRQMCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVL
FYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQE
SSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDE
LSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGD
WLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEED
PEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAE
EGFDVPDCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEF
EREETQDKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKP
CPVCRQPIQMIVLTYFP
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggtgaggagcaggcaaatgtgcaataccaacatgtctgtacctactgatggtgctgta
accacctcacagattccagcttcggaacaagagaccctggttagaccaaagccattgctt
ttgaagttattaaagtctgttggtgcacaaaaagacacttatactatgaaagaggttctt
ttttatcttggccagtatattatgactaaacgattatatgatgagaagcaacaacatatt
gtatattgttcaaatgatcttctaggagatttgtttggcgtgccaagcttctctgtgaaa
gagcacaggaaaatatataccatgatctacaggaacttggtagtagtcaatcagcaggaa
tcatcggactcaggtacatctgtgagtgagaacaggtgtcaccttgaaggtgggagtgat
caaaaggaccttgtacaagagcttcaggaagagaaaccttcatcttcacatttggtttct
agaccatctacctcatctagaaggagagcaattagtgagacagaagaaaattcagatgaa
ttatctggtgaacgacaaagaaaacgccacaaatctgatagtatttccctttcctttgat
gaaagcctggctctgtgtgtaataagggagatatgttgtgaaagaagcagtagcagtgaa
tctacagggacgccatcgaatccggatcttgatgctggtgtaagtgaacattcaggtgat
tggttggatcaggattcagtttcagatcagtttagtgtagaatttgaagttgaatctctc
gactcagaagattatagccttagtgaagaaggacaagaactctcagatgaagatgatgag
gtatatcaagttactgtgtatcaggcaggggagagtgatacagattcatttgaagaagat
cctgaaatttccttagctgactattggaaatgcacttcatgcaatgaaatgaatcccccc
cttccatcacattgcaacagatgttgggcccttcgtgagaattggcttcctgaagataaa
gggaaagataaaggggaaatctctgagaaagccaaactggaaaactcaacacaagctgaa
gagggctttgatgttcctgattgtaaaaaaactatagtgaatgattccagagagtcatgt
gttgaggaaaatgatgataaaattacacaagcttcacaatcacaagaaagtgaagactat
tctcagccatcaacttctagtagcattatttatagcagccaagaagatgtgaaagagttt
gaaagggaagaaacccaagacaaagaagagagtgtggaatctagtttgccccttaatgcc
attgaaccttgtgtgatttgtcaaggtcgacctaaaaatggttgcattgtccatggcaaa
acaggacatcttatggcctgctttacatgtgcaaagaagctaaagaaaaggaataagccc
tgcccagtatgtagacaaccaattcaaatgattgtgctaacttatttcccctag

KEGG   Homo sapiens (human): 4734Help
Entry
4734              CDS       T01001                                 

Gene name
NEDD4, NEDD4-1, RPF1
Definition
(RefSeq) NEDD4 E3 ubiquitin protein ligase
  KO
K10591  E3 ubiquitin-protein ligase NEDD4 [EC:2.3.2.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04144  Endocytosis
hsa04530  Tight junction
hsa05169  Epstein-Barr virus infection
Network
nt06120  Calcium signaling (virus)
nt06165  Epstein-Barr virus (EBV)
  Element
N00488  EBV LMP2A to BCR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4734 (NEDD4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4734 (NEDD4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    4734 (NEDD4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    4734 (NEDD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4734 (NEDD4)
   04121 Ubiquitin system [BR:hsa04121]
    4734 (NEDD4)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    4734 (NEDD4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     4734 (NEDD4)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    4734 (NEDD4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   4734 (NEDD4)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Morphogenesis factors
    4734 (NEDD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HECT WW
Motif
Other DBs
NCBI-GeneID: 4734
NCBI-ProteinID: NP_001271267
OMIM: 602278
HGNC: 7727
Ensembl: ENSG00000069869
Vega: OTTHUMG00000132015
Pharos: P46934(Tbio)
UniProt: P46934
LinkDB All DBs
Structure
PDB: 

Position
15q21.3
AA seq 1319 aa AA seqDB search
MAQSLRLHFAARRSNTYPLSETSGDDLDSHVHMCFKRPTRISTSNVVQMKLTPRQTALAP
LIKENVQSQERSSVPSSENVNKKSSCLQISLQPTRYSGYLQSSNVLADSDDASFTCILKD
GIYSSAVVDNELNAVNDGHLVSSPAICSGSLSNFSTSDNGSYSSNGSDFGSCASITSGGS
YTNSVISDSSSYTFPPSDDTFLGGNLPSDSTSNRSVPNRNTTPCEIFSRSTSTDPFVQDD
LEHGLEIMKLPVSRNTKIPLKRYSSLVIFPRSPSTTRPTSPTSLCTLLSKGSYQTSHQFI
ISPSEIAHNEDGTSAKGFLSTAVNGLRLSKTICTPGEVRDIRPLHRKGSLQKKIVLSNNT
PRQTVCEKSSEGYSCVSVHFTQRKAATLDCETTNGDCKPEMSEIKLNSDSEYIKLMHRTS
ACLPSSQNVDCQININGELERPHSQMNKNHGILRRSISLGGAYPNISCLSSLKHNCSKGG
PSQLLIKFASGNEGKVDNLSRDSNRDCTNELSNSCKTRDDFLGQVDVPLYPLPTENPRLE
RPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKTSGSEDDNAEQAEELEPGWVVLDQPDAA
CHLQQQQEPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDNLTDAENGNIQLQAQ
RAFTTRRQISEETESVDNRESSENWEIIREDEATMYSNQAFPSPPPSSNLDVPTHLAEEL
NARLTIFGNSAVSQPASSSNHSSRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDER
GRSYYVDHNSRTTTWTKPTVQATVETSQLTSSQSSAGPQSQASTSDSGQQVTQPSEIEQG
FLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDTSNDLGPLPPGWEE
RTHTDGRIFYINHNIKRTQWEDPRLENVAITGPAVPYSRDYKRKYEFFRRKLKKQNDIPN
KFEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMF
NPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFY
KMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGSE
IVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLG
DVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAEL
YGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD
NT seq 3960 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaagcttacgattgcactttgcagccagaagaagcaatacttaccctttgtca
gaaacctccggagatgacttggatagccatgttcacatgtgcttcaaaagaccaacacgg
atttcaacgtctaacgttgttcaaatgaagctgactcccagacagactgcactagctccg
ttaataaaggaaaacgttcagtctcaagaaagatcatctgttccctcatctgaaaatgtt
aataaaaagagcagctgtctacagatttcactacagccaacaaggtacagtggatatctt
cagtctagcaatgtcttagctgatagtgatgatgcttcgtttacttgtatcttgaaggat
ggtatttacagtagtgctgtggtcgataatgaattgaatgctgtgaatgatggtcacctt
gtaagcagtccagccatttgtagtggtagccttagtaacttttcaaccagtgataatggg
tcttacagcagcaacggtagtgattttgggtcatgtgcaagtatcacaagtggaggttca
tatactaacagtgtcatcagtgacagtagtagttatacttttccaccaagtgatgatact
tttttgggtggaaacttaccttctgacagcacctccaatagaagtgtgccaaacaggaat
actactccttgtgaaattttttcaagaagtacaagtacagatccttttgtccaggatgac
ttggaacatggattagagattatgaaattgccagtgagcaggaacacaaaaattccacta
aaacgttactcctccttagtcatttttcctaggagtccttcaactacccgaccgacttct
ccaacaagtctgtgtactcttctgagcaaaggatcctatcaaacttcacaccagtttatt
atttctcctagtgaaattgcacataatgaggatggcactagtgctaaaggatttctttca
acagctgtcaatggacttcggttatctaaaacaatttgtacccccggagaagtaagagac
atacggccgcttcacaggaagggctcgttacagaagaaaattgttctttcgaataatact
cccagacagactgtctgtgaaaagtcatctgaaggatattcttgtgtttcagtgcatttc
acccaacgaaaagcagctacattagactgtgaaacaacaaatggtgattgtaaaccagaa
atgtcagaaattaagcttaattctgattcagagtatattaagctcatgcataggacatct
gcatgtttgccatcctcccaaaatgtagattgtcaaataaatatcaatggagaattggaa
agaccacattcacagatgaacaaaaaccatggtattttacgaagaagtatttcattggga
ggagcttatccaaatatttcctgtctatccagccttaagcacaattgttctaaaggggga
ccatctcagttactcataaagtttgcatctggaaatgaaggtaaagtggataatttatca
agagacagcaacagagattgcacaaatgaactgtctaattcttgcaagacaagagatgat
ttcctaggtcaagtggatgttccactttatccattaccgacagaaaatccaagattggag
agaccatatacatttaaggattttgttcttcatccaagaagtcacaaatcaagagttaaa
ggttatctgagactaaaaatgacttatttacctaaaaccagtggctcagaagatgataat
gcagaacaggctgaggaattagagcctggctgggttgttttggaccaaccagatgctgct
tgccatttgcagcaacaacaagaaccttctcctctacctccagggtgggaagagaggcag
gatatccttggaaggacctattatgtaaaccatgaatctagaagaacacagtggaaaaga
ccaacccctcaggacaacctaacagatgctgagaatggcaacattcaactgcaagcacaa
cgtgcatttaccaccaggcggcagatatccgaggaaacagaaagtgttgacaaccgagag
tcttccgagaactgggaaattataagagaagatgaagccaccatgtatagcaaccaggcc
ttcccatcacctccaccgtcaagtaacttggatgttccaactcatcttgcagaagaattg
aatgccagactcaccatttttggaaattcagccgtgagccagccagcatcgagctcaaat
cattccagcagaagaggcagcttacaagcctatacttttgaggaacaacctacacttcct
gtgcttttgcctacttcatctggattaccaccaggttgggaagaaaaacaagatgaaaga
ggaagatcatattatgtagatcacaattccagaacgactacttggacaaagcccactgta
caggccacagtggagaccagtcagctgacctcaagccagagttctgcaggccctcaatca
caagcctccaccagtgattcaggccagcaggtgacccagccatctgaaattgagcaagga
ttccttcctaaaggctgggaagtccggcatgcaccaaatgggaggcctttctttattgac
cacaacactaaaaccaccacctgggaagatccaagattgaaaattccagcccatctgaga
ggaaagacatcacttgatacttccaatgatctagggcctttacctccaggatgggaagag
agaactcacacagatggaagaatcttctacataaatcacaatataaaaagaacacaatgg
gaagatcctcggttggagaatgtagcaataactggaccagcagtgccctactccagggat
tacaaaagaaagtatgagttcttccgaagaaagttgaagaagcagaatgacattccaaac
aaatttgaaatgaaacttcgccgagcaactgttcttgaagactcttaccggagaattatg
ggtgtcaagagagcagacttcctgaaggctcgactgtggattgagtttgatggtgaaaag
ggattggattatggaggagttgccagagaatggttcttcctgatctcaaaggaaatgttt
aacccttattatgggttgtttgaatattctgctacggacaattataccctacagataaat
ccaaactctggattgtgtaacgaagatcacctctcttacttcaagtttattggtcgggta
gctggaatggcagtttatcatggcaaactgttggatggttttttcatccgcccattttac
aagatgatgcttcacaaaccaataacccttcatgatatggaatctgtggatagtgaatat
tacaattccctaagatggattcttgaaaatgacccaacagaattggacctcaggtttatc
atagatgaagaactttttggacagacacatcaacatgagctgaaaaatggtggatcagaa
atagttgtcaccaataagaacaaaaaggaatatatttatcttgtaatacaatggcgattt
gtaaaccgaatccagaagcaaatggctgcttttaaagagggattctttgaactaatacca
caggatctcatcaaaatttttgatgaaaatgaactagagcttcttatgtgtggactggga
gatgttgatgtgaatgactggagggaacatacaaagtataaaaatggctacagtgcaaat
catcaggttatacagtggttttggaaggctgttttaatgatggattcagaaaaaagaata
agattacttcagtttgtcactggcacatctcgggtgcctatgaatggatttgctgaacta
tacggttcaaatggaccacagtcatttacagttgaacagtggggtactcctgaaaagctg
ccaagagctcatacctgttttaatcgcctggacttgccaccttatgaatcatttgaagaa
ttatgggataaacttcagatggcaattgaaaacacccagggctttgatggagttgattag

KEGG   Homo sapiens (human): 57154Help
Entry
57154             CDS       T01001                                 

Gene name
SMURF1
Definition
(RefSeq) SMAD specific E3 ubiquitin protein ligase 1
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04144  Endocytosis
hsa04340  Hedgehog signaling pathway
hsa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    57154 (SMURF1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    57154 (SMURF1)
   04350 TGF-beta signaling pathway
    57154 (SMURF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    57154 (SMURF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    57154 (SMURF1)
   04121 Ubiquitin system [BR:hsa04121]
    57154 (SMURF1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    57154 (SMURF1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     57154 (SMURF1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    57154 (SMURF1)
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    57154 (SMURF1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   57154 (SMURF1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    57154 (SMURF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HECT WW C2 HPS3_N
Motif
Other DBs
NCBI-GeneID: 57154
NCBI-ProteinID: NP_065162
OMIM: 605568
HGNC: 16807
Ensembl: ENSG00000198742
Vega: OTTHUMG00000150272
Pharos: Q9HCE7(Tbio)
UniProt: Q9HCE7
LinkDB All DBs
Structure
PDB: 

Position
7q22.1
AA seq 757 aa AA seqDB search
MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDP
KWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCK
LNPSDTDAVRGQIVVSLQTRDRIGTGGSVVDCRGLLENEGTVYEDSGPGRPLSCFMEEPA
PYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGY
EQRTTVQGQVYFLHTQTGVSTWHDPRIPSPSGTIPGGDAAFLYEFLLQGHTSEPRDLNSV
NCDELGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLHHIMNHQCQLKEPSQPLPLPS
EGSLEDEELPAQRYERDLVQKLKVLRHELSLQQPQAGHCRIEVSREEIFEESYRQIMKMR
PKDLKKRLMVKFRGEEGLDYGGVAREWLYLLCHEMLNPYYGLFQYSTDNIYMLQINPDSS
INPDHLSYFHFVGRIMGLAVFHGHYINGGFTVPFYKQLLGKPIQLSDLESVDPELHKSLV
WILENDITPVLDHTFCVEHNAFGRILQHELKPNGRNVPVTEENKKEYVRLYVNWRFMRGI
EAQFLALQKGFNELIPQHLLKPFDQKELELIIGGLDKIDLNDWKSNTRLKHCVADSNIVR
WFWQAVETFDEERRARLLQFVTGSTRVPLQGFKALQGSTGAAGPRLFTIHLIDANTDNLP
KAHTCFNRIDIPPYESYEKLYEKLLTAVEETCGFAVE
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaccccgggacacgcaggaacggctccagcatcaagatccgtctgacagtgtta
tgtgccaagaaccttgcaaagaaagacttcttcaggctccctgacccttttgcaaagatt
gtcgtggatgggtctgggcagtgccactcaaccgacactgtgaaaaacacattggaccca
aagtggaaccagcactatgatctatatgttgggaaaacggattcgataaccattagcgtg
tggaaccataagaaaattcacaagaaacagggagctggcttcctgggctgtgtgcggctg
ctctccaatgccatcagcagattaaaagataccggataccagcgtttggatctatgcaaa
ctaaacccctcagatactgatgcagttcgtggccagatagtggtcagtttacagacacga
gacagaataggaaccggcggctcggtggtggactgcagaggactgttagaaaatgaagga
acggtgtatgaagactccgggcctgggaggccgctcagctgcttcatggaggaaccagcc
ccttacacagatagcaccggtgctgctgctggaggagggaattgcaggttcgtggagtcc
ccaagtcaagatcaaagacttcaggcacagcggcttcgaaaccctgatgtgcgaggttca
ctacagacgccccagaaccgaccacacggccaccagtccccggaactgcccgaaggctac
gaacaaagaacaacagtccagggccaagtttactttttgcatacacagactggagttagc
acgtggcacgaccccaggataccaagtccctcggggaccattcctgggggagatgcagct
tttctatacgaattccttctacaaggccatacatctgagcccagagaccttaacagtgtg
aactgtgatgaacttggaccactgccgccaggctgggaagtcagaagtacagtttctggg
aggatatattttgtagatcataataaccgaacaacccagtttacagacccaaggttacac
cacatcatgaatcaccagtgccaactcaaggagcccagccagccgctgccactgcccagt
gagggctctctggaggacgaggagcttcctgcccagagatacgaaagagatctagtccag
aagctgaaagtcctcagacacgaactgtcgcttcagcagccccaagctggtcattgccgc
atcgaagtgtccagagaagaaatctttgaggagtcttaccgccagataatgaagatgcga
ccgaaagacttgaaaaaacggctgatggtgaaattccgtggggaagaaggtttggattac
ggtggtgtggccagggagtggctttacttgctgtgccatgaaatgctgaatccttattac
gggctcttccagtattctacggacaatatttacatgttgcaaataaatccggattcttca
atcaaccccgaccacttgtcttatttccactttgtggggcggatcatggggctggctgtg
ttccatggacactacatcaacgggggcttcacagtgcccttctacaagcagctgctgggg
aagcccatccagctctcagatctggaatctgtggacccagagctgcataagagcttggtg
tggatcctagagaacgacatcacgcctgtactggaccacaccttctgcgtggaacacaac
gccttcgggcggatcctgcagcatgaactgaaacccaatggcagaaatgtgccagtcaca
gaggagaataagaaagaatacgtccggttgtatgtaaactggaggtttatgagaggaatc
gaagcccagttcttagctctgcagaaggggttcaatgagctcatccctcaacatctgctg
aagccttttgaccagaaggaactggagctgatcataggcggcctggataaaatagacttg
aacgactggaagtcgaacacgcggctgaagcactgtgtggccgacagcaacatcgtgcgg
tggttctggcaagcggtggagacgttcgatgaagaaaggagggccaggctcctgcagttt
gtgactgggtccacgcgagtcccgctccaaggcttcaaggctttgcaaggttctacaggc
gcggcagggccccggctgttcaccatccacctgatagacgcgaacacagacaaccttccg
aaggcccatacctgctttaaccggatcgacattccaccatatgagtcctatgagaagctc
tacgagaagctgctgacagccgtggaggagacctgcgggtttgctgtggagtga

KEGG   Homo sapiens (human): 64750Help
Entry
64750             CDS       T01001                                 

Gene name
SMURF2
Definition
(RefSeq) SMAD specific E3 ubiquitin protein ligase 2
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04144  Endocytosis
hsa04340  Hedgehog signaling pathway
hsa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    64750 (SMURF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    64750 (SMURF2)
   04350 TGF-beta signaling pathway
    64750 (SMURF2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    64750 (SMURF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    64750 (SMURF2)
   04121 Ubiquitin system [BR:hsa04121]
    64750 (SMURF2)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    64750 (SMURF2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     64750 (SMURF2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    64750 (SMURF2)
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    64750 (SMURF2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   64750 (SMURF2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    64750 (SMURF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HECT WW C2
Motif
Other DBs
NCBI-GeneID: 64750
NCBI-ProteinID: NP_073576
OMIM: 605532
HGNC: 16809
Ensembl: ENSG00000108854
Vega: OTTHUMG00000179189
Pharos: Q9HAU4(Tbio)
UniProt: Q9HAU4 Q96DE7
LinkDB All DBs
Structure
PDB: 

Position
17q23.3-q24.1
AA seq 748 aa AA seqDB search
MSNPGGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPK
WNQHYDLYIGKSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKL
GPNDNDTVRGQIVVSLQSRDRIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHIT
RTTQWERPTRPASEYSSPGRPLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRN
YMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLP
PGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQVVSLCPDDT
ECLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWK
RLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHL
SYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILEND
ITGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLA
LQKGFNEVIPQHLLKTFDEKELELIICGLGKIDVNDWKVNTRLKHCTPDSNIVKWFWKAV
EFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLPKAHTCFNRI
DIPPYESYEKLYEKLLTAIEETCGFAVE
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaccccggaggccggaggaacgggcccgtcaagctgcgcctgacagtactctgt
gcaaaaaacctggtgaaaaaggattttttccgacttcctgatccatttgctaaggtggtg
gttgatggatctgggcaatgccattctacagatactgtgaagaatacgcttgatccaaag
tggaatcagcattatgacctgtatattggaaagtctgattcagttacgatcagtgtatgg
aatcacaagaagatccataagaaacaaggtgctggatttctcggttgtgttcgtcttctt
tccaatgccatcaaccgcctcaaagacactggttatcagaggttggatttatgcaaactc
gggccaaatgacaatgatacagttagaggacagatagtagtaagtcttcagtccagagac
cgaataggcacaggaggacaagttgtggactgcagtcgtttatttgataacgatttacca
gacggctgggaagaaaggagaaccgcctctggaagaatccagtatctaaaccatataaca
agaactacgcaatgggagcgcccaacacgaccggcatccgaatattctagccctggcaga
cctcttagctgctttgttgatgagaacactccaattagtggaacaaatggtgcaacatgt
ggacagtcttcagatcccaggctggcagagaggagagtcaggtcacaacgacatagaaat
tacatgagcagaacacatttacatactcctccagacctaccagaaggctatgaacagagg
acaacgcaacaaggccaggtgtatttcttacatacacagactggtgtgagcacatggcat
gatccaagagtgcccagggatcttagcaacatcaattgtgaagagcttggtccattgcct
cctggatgggagatccgtaatacggcaacaggcagagtttatttcgttgaccataacaac
agaacaacacaatttacagatcctcggctgtctgctaacttgcatttagttttaaatcgg
cagaaccaattgaaagaccaacagcaacagcaagtggtatcgttatgtcctgatgacaca
gaatgcctgacagtcccaaggtacaagcgagacctggttcagaaactaaaaattttgcgg
caagaactttcccaacaacagcctcaggcaggtcattgccgcattgaggtttccagggaa
gagatttttgaggaatcatatcgacaggtcatgaaaatgagaccaaaagatctctggaag
cgattaatgataaaatttcgtggagaagaaggccttgactatggaggcgttgccagggaa
tggttgtatctcttgtcacatgaaatgttgaatccatactatggcctcttccagtattca
agagatgatatttatacattgcagatcaatcctgattctgcagttaatccggaacattta
tcctatttccactttgttggacgaataatgggaatggctgtgtttcatggacattatatt
gatggtggtttcacattgcctttttataagcaattgcttgggaagtcaattaccttggat
gacatggagttagtagatccggatcttcacaacagtttagtgtggatacttgagaatgat
attacaggtgttttggaccataccttctgtgttgaacataatgcatatggtgaaattatt
cagcatgaacttaaaccaaatggcaaaagtatccctgttaatgaagaaaataaaaaagaa
tatgtcaggctctatgtgaactggagatttttacgaggcattgaggctcaattcttggct
ctgcagaaaggatttaatgaagtaattccacaacatctgctgaagacatttgatgagaag
gagttagagctcattatttgtggacttggaaagatagatgttaatgactggaaggtaaac
acccggttaaaacactgtacaccagacagcaacattgtcaaatggttctggaaagctgtg
gagttttttgatgaagagcgacgagcaagattgcttcagtttgtgacaggatcctctcga
gtgcctctgcagggcttcaaagcattgcaaggtgctgcaggcccgagactctttaccata
caccagattgatgcctgcactaacaacctgccgaaagcccacacttgcttcaatcgaata
gacattccaccctatgaaagctatgaaaagctatatgaaaagctgctaacagccattgaa
gaaacatgtggatttgctgtggaatga

KEGG   Homo sapiens (human): 7189Help
Entry
7189              CDS       T01001                                 

Gene name
TRAF6, MGC:3310, RNF85
Definition
(RefSeq) TNF receptor associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04140  Autophagy - animal
hsa04144  Endocytosis
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Network
nt06110  MAPK signaling (virus)
nt06121  TLR signaling (virus)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06211  Other MAPK signaling
nt06263  Hepatocellular carcinoma
  Element
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00466  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00549  HBV HBeAg to TLR2/4-NFKB signaling pathway
N00556  HBV HBe to TLR2/4-NFKB signaling pathway
N00557  HBV HBe to TLR2/4-NFKB signaling pathway
N00561  HSV ICP0 to TLR2/4-NFKB signaling pathway
N00562  HSV US3 to TLR2/4-NFKB signaling pathway
N00563  TLR3-NFKB signaling pathway
N00564  HSV US3 to TLR3-NFKB signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7189 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7189 (TRAF6)
   04064 NF-kappa B signaling pathway
    7189 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    7189 (TRAF6)
   04140 Autophagy - animal
    7189 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    7189 (TRAF6)
   04621 NOD-like receptor signaling pathway
    7189 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    7189 (TRAF6)
   04657 IL-17 signaling pathway
    7189 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    7189 (TRAF6)
  09158 Development
   04380 Osteoclast differentiation
    7189 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7189 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    7189 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    7189 (TRAF6)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    7189 (TRAF6)
   05133 Pertussis
    7189 (TRAF6)
   05152 Tuberculosis
    7189 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    7189 (TRAF6)
   05162 Measles
    7189 (TRAF6)
   05161 Hepatitis B
    7189 (TRAF6)
   05160 Hepatitis C
    7189 (TRAF6)
   05168 Herpes simplex virus 1 infection
    7189 (TRAF6)
   05169 Epstein-Barr virus infection
    7189 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    7189 (TRAF6)
   05140 Leishmaniasis
    7189 (TRAF6)
   05142 Chagas disease (American trypanosomiasis)
    7189 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7189 (TRAF6)
   04121 Ubiquitin system [BR:hsa04121]
    7189 (TRAF6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     7189 (TRAF6)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    7189 (TRAF6)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    7189 (TRAF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 zf-RING_5 SlyX U-box Tropomyosin_1 zf-RING_11 Spc29 ADIP EzrA UPF0242 DUF16 DM Dynactin_p22 Sina FliJ AAA_13 Filament CENP-F_leu_zip DUF3450 HMMR_N DUF1664 PspA_IM30 Lebercilin
Motif
Other DBs
NCBI-GeneID: 7189
NCBI-ProteinID: NP_004611
OMIM: 602355
HGNC: 12036
Ensembl: ENSG00000175104
Vega: OTTHUMG00000166391
Pharos: Q9Y4K3(Tbio)
UniProt: Q9Y4K3
LinkDB All DBs
Structure
PDB: 

Position
11p12
AA seq 522 aa AA seqDB search
MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILK
DCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIH
QLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNF
GMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS
HLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE
ALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgctaaactgtgaaaacagctgtggatccagccagtctgaaagtgactgctgt
gtggccatggccagctcctgtagcgctgtaacaaaagatgatagtgtgggtggaactgcc
agcacggggaacctctccagctcatttatggaggagatccagggatatgatgtagagttt
gacccacccctggaaagcaagtatgaatgccccatctgcttgatggcattacgagaagca
gtgcaaacgccatgcggccataggttctgcaaagcctgcatcataaaatcaataagggat
gcaggtcacaaatgtccagttgacaatgaaatactgctggaaaatcaactatttccagac
aattttgcaaaacgtgagattctttctctgatggtgaaatgtccaaatgaaggttgtttg
cacaagatggaactgagacatcttgaggatcatcaagcacattgtgagtttgctcttatg
gattgtccccaatgccagcgtcccttccaaaaattccatattaatattcacattctgaag
gattgtccaaggagacaggtttcttgtgacaactgtgctgcatcaatggcatttgaagat
aaagagatccatgaccagaactgtcctttggcaaatgtcatctgtgaatactgcaatact
atactcatcagagaacagatgcctaatcattatgatctagactgccctacagccccaatt
ccatgcacattcagtacttttggttgccatgaaaagatgcagaggaatcacttggcacgc
cacctacaagagaacacccagtcacacatgagaatgttggcccaggctgttcatagtttg
agcgttatacccgactctgggtatatctcagaggtccggaatttccaggaaactattcac
cagttagagggtcgccttgtaagacaagaccatcaaatccgggagctgactgctaaaatg
gaaactcagagtatgtatgtaagtgagctcaaacgaaccattcgaacccttgaggacaaa
gttgctgaaatcgaagcacagcagtgcaatggaatttatatttggaagattggcaacttt
ggaatgcatttgaaatgtcaagaagaggagaaacctgttgtgattcatagccctggattc
tacactggcaaacccgggtacaaactgtgcatgcgcttgcaccttcagttaccgactgct
cagcgctgtgcaaactatatatccctttttgtccacacaatgcaaggagaatatgacagc
cacctcccttggcccttccagggtacaatacgccttacaattcttgatcagtctgaagca
cctgtaaggcaaaaccacgaagagataatggatgccaaaccagagctgcttgctttccag
cgacccacaatcccacggaacccaaaaggttttggctatgtaacttttatgcatctggaa
gccctaagacaaagaactttcattaaggatgacacattattagtgcgctgtgaggtctcc
acccgctttgacatgggtagccttcggagggagggttttcagccacgaagtactgatgca
ggggtatag

KEGG   Homo sapiens (human): 83737Help
Entry
83737             CDS       T01001                                 

Gene name
ITCH, ADMFD, AIF4, AIP4, NAPP1
Definition
(RefSeq) itchy E3 ubiquitin protein ligase
  KO
K05632  E3 ubiquitin-protein ligase Itchy [EC:2.3.2.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04144  Endocytosis
hsa04668  TNF signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
Disease
H01232  Syndromic multisystem autoimmune disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    83737 (ITCH)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    83737 (ITCH)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    83737 (ITCH)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    83737 (ITCH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    83737 (ITCH)
   04121 Ubiquitin system [BR:hsa04121]
    83737 (ITCH)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     83737 (ITCH)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    83737 (ITCH)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   83737 (ITCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HECT WW C2
Motif
Other DBs
NCBI-GeneID: 83737
NCBI-ProteinID: NP_001244066
OMIM: 606409
HGNC: 13890
Ensembl: ENSG00000078747
Vega: OTTHUMG00000032300
Pharos: Q96J02(Tbio)
UniProt: Q96J02
LinkDB All DBs
Structure
PDB: 

Position
20q11.22
AA seq 903 aa AA seqDB search
MSDSGSQLGSMGSLTMKSQLQITVISAKLKENKKNWFGPSPYVEVTVDGQSKKTEKCNNT
NSPKWKQPLTVIVTPVSKLHFRVWSHQTLKSDVLLGTAALDIYETLKSNNMKLEEVVVTL
QLGGDKEPTETIGDLSICLDGLQLESEVVTNGETTCSENGVSLCLPRLECNSAISAHCNL
CLPGLSDSPISASRVAGFTGASQNDDGSRSKDETRVSTNGSDDPEDAGAGENRRVSGNNS
PSLSNGGFKPSRPPRPSRPPPPTPRRPASVNGSPSATSESDGSSTGSLPPTNTNTNTSEG
ATSGLIIPLTISGGSGPRPLNPVTQAPLPPGWEQRVDQHGRVYYVDHVEKRTTWDRPEPL
PPGWERRVDNMGRIYYVDHFTRTTTWQRPTLESVRNYEQWQLQRSQLQGAMQQFNQRFIY
GNQDLFATSQSKEFDPLGPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQGQLNEKPL
PEGWEMRFTVDGIPYFVDHNRRTTTYIDPRTGKSALDNGPQIAYVRDFKAKVQYFRFWCQ
QLAMPQHIKITVTRKTLFEDSFQQIMSFSPQDLRRRLWVIFPGEEGLDYGGVAREWFFLL
SHEVLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFRFIGRFIAMALFHGKFIDTGFS
LPFYKRILNKPVGLKDLESIDPEFYNSLIWVKENNIEECDLEMYFSVDKEILGEIKSHDL
KPNGGNILVTEENKEEYIRMVAEWRLSRGVEEQTQAFFEGFNEILPQQYLQYFDAKELEV
LLCGMQEIDLNDWQRHAIYRHYARTSKQIMWFWQFVKEIDNEKRMRLLQFVTGTCRLPVG
GFADLMGSNGPQKFCIEKVGKENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGF
GQE
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacagtggatcacaacttggttcaatgggtagcctcaccatgaaatcacagctt
cagatcactgtcatctcagcaaaacttaaggaaaataagaagaattggtttggaccaagt
ccttacgtagaggtcacagtagatggacagtcaaagaagacagaaaaatgcaacaacaca
aacagtcccaagtggaagcaaccccttacagttatcgttacccctgtgagtaaattacat
tttcgtgtgtggagtcaccagacactgaaatctgatgttttgttgggaactgctgcatta
gatatttatgaaacattaaagtcaaacaatatgaaacttgaagaagtagttgtgactttg
cagcttggaggtgacaaagagccaacagagacaataggagacttgtcaatttgtcttgat
gggctacagttagagtctgaagttgttaccaatggtgaaactacatgttcagaaaatggg
gtttcgctctgtttgcccaggctggagtgcaatagtgcgatctcggctcactgcaacctc
tgcctcccgggtttaagtgattctcctatctcagcctcccgagtagctgggtttacaggt
gcttctcagaatgatgatggctccagatccaaggatgaaacaagagtgagcacaaatgga
tcagatgaccctgaagatgcaggagctggtgaaaataggagagtcagtgggaataattct
ccatcactctcaaatggtggttttaaaccttctagacctccaagaccttcacgaccacca
ccacccaccccacgtagaccagcatctgtcaatggttcaccatctgccacttctgaaagt
gatgggtctagtacaggctctctgccgccgacaaatacaaatacaaatacatctgaagga
gcaacatctggattaataattcctcttactatatctggaggctcaggccctaggccatta
aatcctgtaactcaagctcccttgccacctggttgggagcagagagtggaccagcacggg
cgagtttactatgtagatcatgttgagaaaagaacaacatgggatagaccagaacctcta
cctcctggctgggaacggcgggttgacaacatgggacgtatttattatgttgaccatttc
acaagaacaacaacgtggcagaggccaacactggaatccgtccggaactatgaacaatgg
cagctacagcgtagtcagcttcaaggagcaatgcagcagtttaaccagagattcatttat
gggaatcaagatttatttgctacatcacaaagtaaagaatttgatcctcttggtccattg
ccacctggatgggagaagagaacagacagcaatggcagagtatatttcgtcaaccacaac
acacgaattacacaatgggaagaccccagaagtcaaggtcaattaaatgaaaagccctta
cctgaaggttgggaaatgagattcacagtggatggaattccatattttgtggaccacaat
agaagaactaccacctatatagatccccgcacaggaaaatctgccctagacaatggacct
cagatagcctatgttcgggacttcaaagcaaaggttcagtatttccggttctggtgtcag
caactggccatgccacagcacataaagattacagtgacaagaaaaacattgtttgaggat
tcctttcaacagataatgagcttcagtccccaagatctgcgaagacgtttgtgggtgatt
tttccaggagaagaaggtttagattatggaggtgtagcaagagaatggttctttcttttg
tcacatgaagtgttgaacccaatgtattgcctgtttgaatatgcagggaaggataactac
tgcttgcagataaaccccgcttcttacatcaatccagatcacctgaaatattttcgtttt
attggcagatttattgccatggctctgttccatgggaaattcatagacacgggtttttct
ttaccattctataagcgtatcttgaacaaaccagttggactcaaggatttagaatctatt
gatccagaattttacaattctctcatctgggttaaggaaaacaatattgaggaatgtgat
ttggaaatgtacttctccgttgacaaagaaattctaggtgaaattaagagtcatgatctg
aaacctaatggtggcaatattcttgtaacagaagaaaataaagaggaatacatcagaatg
gtagctgagtggaggttgtctcgaggtgttgaagaacagacacaagctttctttgaaggc
tttaatgaaattcttccccagcaatatttgcaatactttgatgcaaaggaattagaggtc
cttttatgtggaatgcaagagattgatttgaatgactggcaaagacatgccatctaccgt
cattatgcaaggaccagcaaacaaatcatgtggttttggcagtttgttaaagaaattgat
aatgagaagagaatgagacttctgcagtttgttactggaacctgccgattgccagtagga
ggatttgctgatctcatggggagcaatggaccacagaaattctgcattgaaaaagttggg
aaagaaaattggctacccagaagtcatacctgttttaatcgcctggacctgccaccatac
aagagctatgagcaactgaaggaaaagctgttgtttgccatagaagaaacagaaggattt
ggacaagagtaa

KEGG   Homo sapiens (human): 867Help
Entry
867               CDS       T01001                                 

Gene name
CBL, C-CBL, CBL2, FRA11B, NSLL, RNF55
Definition
(RefSeq) Cbl proto-oncogene
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04144  Endocytosis
hsa04910  Insulin signaling pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05220  Chronic myeloid leukemia
Network
nt06214  PI3K signaling
nt06276  Chronic myeloid leukemia
  Element
N00048  BCR-ABL fusion kinase to PI3K signaling pathway
Disease
H00523  Noonan syndrome and related disorders
H02190  CBL syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    867 (CBL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    867 (CBL)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    867 (CBL)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    867 (CBL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    867 (CBL)
   05205 Proteoglycans in cancer
    867 (CBL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    867 (CBL)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    867 (CBL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    867 (CBL)
   04121 Ubiquitin system [BR:hsa04121]
    867 (CBL)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     867 (CBL)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    867 (CBL)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    867 (CBL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 UBA zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-rbx1 zf-C3HC4_4 zf-RING_4
Motif
Other DBs
NCBI-GeneID: 867
NCBI-ProteinID: NP_005179
OMIM: 165360
HGNC: 1541
Ensembl: ENSG00000110395
Vega: OTTHUMG00000166170
Pharos: P22681(Tbio)
UniProt: P22681
LinkDB All DBs
Structure
PDB: 

Position
11q23.3
AA seq 906 aa AA seqDB search
MAGNVKKSSGAGGGSGSGGSGSGGLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCW
KLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFME
NLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFR
ITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFE
FDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRL
GQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDH
IKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCR
CEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDTLFMMKELAGAKVER
PPSPFSMAPQASLPPVPPRLDLLPQRVCVPSSASALGTASKAASGSLHKDKPLPVPPTLR
DLPPPPPPDRPYSVGAESRPQRRPLPCTPGDCPSRDKLPPVPSSRLGDSWLPRPIPKVPV
SAPSSSDPWTGRELTNRHSLPFSLPSQMEPRPDVPRLGSTFSLDTSMSMNSSPLVGPECD
HPKIKPSSSANAIYSLAARPLPVPKLPPGEQCEGEEDTEYMTPSSRPLRPLDTSQSSRAC
DCDQQIDSCTYEAMYNIQSQAPSITESSTFGEGNLAAAHANTGPEESENEDDGYDVPKPP
VPAVLARRTLSDISNASSSFGWLSLDGDPTTNVTEGSQVPERPPKPFPRRINSERKAGSC
QQGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISS
PAHVAT
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaacgtgaagaagagctctggggccgggggcggcagcggctccgggggctcg
ggttcgggtggcctgattgggctcatgaaggacgccttccagccgcaccaccaccaccac
caccacctcagcccccacccgccggggacggtggacaagaagatggtggagaagtgctgg
aagctcatggacaaggtggtgcggttgtgtcagaacccaaagctggcgctaaagaatagc
ccaccttatatcttagacctgctaccagatacctaccagcatctccgtactatcttgtca
agatatgaggggaagatggagacacttggagaaaatgagtattttagggtgtttatggag
aatttgatgaagaaaactaagcaaaccataagcctcttcaaggagggaaaagaaagaatg
tatgaggagaattctcagcctaggcgaaacctaaccaaactgtccctcatcttcagccac
atgctggcagaactaaaaggaatctttccaagtggactctttcagggagacacatttcgg
attactaaagcagatgctgcggaattttggagaaaagcttttggggaaaagacaatagtc
ccttggaagagctttcgacaggctctacatgaagtgcatcccatcagttctgggctggag
gccatggctctgaaatccactattgatctgacctgcaatgattatatttcggtttttgaa
tttgacatctttacccgactctttcagccctggtcctctttgctcaggaattggaacagc
cttgctgtaactcatcctggctacatggcttttttgacgtatgacgaagtgaaagctcgg
ctccagaaattcattcacaaacctggcagttatatcttccggctgagctgtactcgtctg
ggtcagtgggctattgggtatgttactgctgatgggaacattctccagacaatccctcac
aataaacctctcttccaagcactgattgatggcttcagggaaggcttctatttgtttcct
gatggacgaaatcagaatcctgatctgactggcttatgtgaaccaactccccaagaccat
atcaaagtgacccaggaacaatatgaattatactgtgagatgggctccacattccaacta
tgtaaaatatgtgctgaaaatgataaggatgtaaagattgagccctgtggacacctcatg
tgcacatcctgtcttacatcctggcaggaatcagaaggtcagggctgtcctttctgccga
tgtgaaattaaaggtactgaacccatcgtggtagatccgtttgatcctagagggagtggc
agcctgttgaggcaaggagcagagggagctccctccccaaattatgatgatgatgatgat
gaacgagctgatgatactctcttcatgatgaaggaattggctggtgccaaggtggaacgg
ccgccttctccattctccatggccccacaagcttcccttcccccggtgccaccacgactt
gaccttctgccgcagcgagtatgtgttccctcaagtgcttctgctcttggaactgcttct
aaggctgcttctggctcccttcataaagacaaaccattgccagtacctcccacacttcga
gatcttccaccaccaccgcctccagaccggccatattctgttggagcagaatcccgacct
caaagacgccccttgccttgtacaccaggcgactgtccctccagagacaaactgccccct
gtcccctctagccgccttggagactcatggctgccccggccaatccccaaagtaccagta
tctgccccaagttccagtgatccctggacaggaagagaattaaccaaccggcactcactt
ccattttcattgccctcacaaatggagcccagaccagatgtgcctaggctcggaagcacg
ttcagtctggatacctccatgagtatgaatagcagcccattagtaggtccagagtgtgac
caccccaaaatcaaaccttcctcatctgccaatgccatttattctctggctgccagacct
cttcctgtgccaaaactgccacctggggagcaatgtgagggtgaagaggacacagagtac
atgactccctcttccaggcctctacggcctttggatacatcccagagttcacgagcatgt
gattgcgaccagcagattgatagctgtacgtatgaagcaatgtataatattcagtcccag
gcgccatctatcaccgagagcagcacctttggtgaagggaatttggccgcagcccatgcc
aacactggtcccgaggagtcagaaaatgaggatgatgggtatgatgtcccaaagccacct
gtgccggccgtgctggcccgccgaactctctcagatatctctaatgccagctcctccttt
ggctggttgtctctggatggtgatcctacaacaaatgtcactgaaggttcccaagttccc
gagaggcctccaaaaccattcccgcggagaatcaactctgaacggaaagctggcagctgt
cagcaaggtagtggtcctgccgcctctgctgccaccgcctcacctcagctctccagtgag
atcgagaacctcatgagtcaggggtactcctaccaggacatccagaaagctttggtcatt
gcccagaacaacatcgagatggccaaaaacatcctccgggaatttgtttccatttcttct
cctgcccatgtagctacctag

KEGG   Homo sapiens (human): 868Help
Entry
868               CDS       T01001                                 

Gene name
CBLB, Cbl-b, Nbla00127, RNF56
Definition
(RefSeq) Cbl proto-oncogene B
  KO
K22517  E3 ubiquitin-protein ligase CBL-B [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04144  Endocytosis
hsa04625  C-type lectin receptor signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04910  Insulin signaling pathway
hsa05162  Measles
Network
nt06114  PI3K signaling (virus)
nt06169  Measles virus (MV)
  Element
N00684  MV F/H to CD28-PI3K signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    868 (CBLB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    868 (CBLB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    868 (CBLB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    868 (CBLB)
   04660 T cell receptor signaling pathway
    868 (CBLB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    868 (CBLB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    868 (CBLB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    868 (CBLB)
   04121 Ubiquitin system [BR:hsa04121]
    868 (CBLB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     868 (CBLB)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    868 (CBLB)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    868 (CBLB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-C3HC4_4 zf-rbx1 UBA zf-RING_4
Motif
Other DBs
NCBI-GeneID: 868
NCBI-ProteinID: NP_001308717
OMIM: 604491
HGNC: 1542
Ensembl: ENSG00000114423
Vega: OTTHUMG00000150654
Pharos: Q13191(Tbio)
UniProt: Q13191
LinkDB All DBs
Structure
PDB: 

Position
3q13.11
AA seq 982 aa AA seqDB search
MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
TGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTS
PGSSPLAQRRKPQPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQ
DKPLPAPPPPLRDPPPPPPERPPPIPPDNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFG
TNQLVGCRLLGEGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHL
GSEEYDVPPRLSPPPPVTTLLPSIKCTGPLANSLSEKTRDPVEEDDDEYKIPSSHPVSLN
SQPSHCHNVKPPVRSCDNGHCMLNGTHGPSSEKKSNIPDLSIYLKGDVFDSASDPVPLPP
ARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLIEHSKPPG
SSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQ
APARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNNV
EVARSILREFAFPPPVSPRLNL
NT seq 2949 nt NT seq  +upstreamnt  +downstreamnt
atggcaaactcaatgaatggcagaaaccctggtggtcgaggaggaaatccccgaaaaggt
cgaattttgggtattattgatgctattcaggatgcagttggaccccctaagcaagctgcc
gcagatcgcaggaccgtggagaagacttggaagctcatggacaaagtggtaagactgtgc
caaaatcccaaacttcagttgaaaaatagcccaccatatatacttgatattttgcctgat
acatatcagcatttacgacttatattgagtaaatatgatgacaaccagaaacttgcccaa
ctcagtgagaatgagtactttaaaatctacattgatagccttatgaaaaagtcaaaacgg
gcaataagactctttaaagaaggcaaggagagaatgtatgaagaacagtcacaggacaga
cgaaatctcacaaaactgtcccttatcttcagtcacatgctggcagaaatcaaagcaatc
tttcccaatggtcaattccagggagataactttcgtatcacaaaagcagatgctgctgaa
ttctggagaaagttttttggagacaaaactatcgtaccatggaaagtattcagacagtgc
cttcatgaggtccaccagattagctctggcctggaagcaatggctctaaaatcaacaatt
gatttaacttgcaatgattacatttcagtttttgaatttgatatttttaccaggctgttt
cagccttggggctctattttgcggaattggaatttcttagctgtgacacatccaggttac
atggcatttctcacatatgatgaagttaaagcacgactacagaaatatagcaccaaaccc
ggaagctatattttccggttaagttgcactcgattgggacagtgggccattggctatgtg
actggggatgggaatatcttacagaccatacctcataacaagcccttatttcaagccctg
attgatggcagcagggaaggattttatctttatcctgatgggaggagttataatcctgat
ttaactggattatgtgaacctacacctcatgaccatataaaagttacacaggaacaatat
gaattatattgtgaaatgggctccacttttcagctctgtaagatttgtgcagagaatgac
aaagatgtcaagattgagccttgtgggcatttgatgtgcacctcttgccttacggcatgg
caggagtcggatggtcagggctgccctttctgtcgttgtgaaataaaaggaactgagccc
ataatcgtggacccctttgatccaagagatgaaggctccaggtgttgcagcatcattgac
ccctttggcatgccgatgctagacttggacgacgatgatgatcgtgaggagtccttgatg
atgaatcggttggcaaacgtccgaaagtgcactgacaggcagaactcaccagtcacatca
ccaggatcctctccccttgcccagagaagaaagccacagcctgacccactccagatccca
catctaagcctgccacccgtgcctcctcgcctggatctaattcagaaaggcatagttaga
tctccctgtggcagcccaacgggttcaccaaagtcttctccttgcatggtgagaaaacaa
gataaaccactcccagcaccacctcctcccttaagagatcctcctccaccgccacctgaa
agacctccaccaatcccaccagacaatagactgagtagacacatccatcatgtggaaagc
gtgccttccagagacccgccaatgcctcttgaagcatggtgccctcgggatgtgtttggg
actaatcagcttgtgggatgtcgactcctaggggagggctctccaaaacctggaatcaca
gcgagttcaaatgtcaatggaaggcacagtagagtgggctctgacccagtgcttatgcgg
aaacacagacgccatgatttgcctttagaaggagctaaggtcttttccaatggtcacctt
ggaagtgaagaatatgatgttcctccccggctttctcctcctcctccagttaccaccctc
ctccctagcataaagtgtactggtccgttagcaaattctctttcagagaaaacaagagac
ccagtagaggaagatgatgatgaatacaagattccttcatcccaccctgtttccctgaat
tcacaaccatctcattgtcataatgtaaaacctcctgttcggtcttgtgataatggtcac
tgtatgctgaatggaacacatggtccatcttcagagaagaaatcaaacatccctgactta
agcatatatttaaagggagatgtttttgattcagcctctgatcccgtgccattaccacct
gccaggcctccaactcgggacaatccaaagcatggttcttcactcaacaggacgccctct
gattatgatcttctcatccctccattaggtgaagatgcttttgatgccctccctccatct
ctcccacctcccccacctcctgcaaggcatagtctcattgaacattcaaaacctcctggc
tccagtagccggccatcctcaggacaggatctttttcttcttccttcagatccctttgtt
gatctagcaagtggccaagttcctttgcctcctgctagaaggttaccaggtgaaaatgtc
aaaactaacagaacatcacaggactatgatcagcttccttcatgttcagatggttcacag
gcaccagccagaccccctaaaccacgaccgcgcaggactgcaccagaaattcaccacaga
aaaccccatgggcctgaggcggcattggaaaatgtcgatgcaaaaattgcaaaactcatg
ggagagggttatgcctttgaagaggtgaagagagccttagagatagcccagaataatgtc
gaagttgcccggagcatcctccgagaatttgccttccctcctccagtatccccacgtcta
aatctatag

DBGET integrated database retrieval system