KEGG   Homo sapiens (human): 10195Help
Entry
10195             CDS       T01001                                 

Gene name
ALG3, CDG1D, CDGS4, CDGS6, D16Ertd36e, NOT56L, Not56, not
Definition
(RefSeq) ALG3 alpha-1,3- mannosyltransferase
  KO
K03845  alpha-1,3-mannosyltransferase [EC:2.4.1.258]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00055  N-glycan precursor biosynthesis
Network
nt06015  N-Glycan precursor biosynthesis
  Element
N00659  ALG9 deficiency in N-glycan precursor biosynthesis
N00660  ALG12 deficiency in N-glycan precursor biosynthesis
N00661  ALG3 deficiency in N-glycan precursor biosynthesis
N00680  N-Glycan precursor biosynthesis, ALG3 to ALG9
Disease
H00118  Congenital disorders of glycosylation type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    10195 (ALG3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    10195 (ALG3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.258  dolichyl-P-Man:Man5GlcNAc2-PP-dolichol alpha-1,3-mannosyltransferase
     10195 (ALG3)
Glycosyltransferases [BR:hsa01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   10195 (ALG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ALG3 EpsG
Motif
Other DBs
NCBI-GeneID: 10195
NCBI-ProteinID: NP_005778
OMIM: 608750
HGNC: 23056
Ensembl: ENSG00000214160
Vega: OTTHUMG00000156823
Pharos: Q92685(Tdark)
UniProt: Q92685
LinkDB All DBs
Position
3q27.1
AA seq 438 aa AA seqDB search
MAAGLRKRGRSGSAAQAEGLCKQWLQRAWQERRLLLREPRYTLLVAACLCLAEVGITFWV
IHRVAYTEIDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTD
IRMAQNIFAVLYLATLLLVFLIYHQTCKVPPFVFFFMCCASYRVHSIFVLRLFNDPVAMV
LLFLSINLLLAQRWGWGCCFFSLAVSVKMNVLLFAPGLLFLLLTQFGFRGALPKLGICAG
LQVVLGLPFLLENPSGYLSRSFDLGRQFLFHWTVNWRFLPEALFLHRAFHLALLTAHLTL
LLLFALCRWHRTGESILSLLRDPSKRKVPPQPLTPNQIVSTLFTSNFIGICFSRSLHYQF
YVWYFHTLPYLLWAMPARWLTHLLRLLVLGLIELSWNTYPSTSCSSAALHICHAVILLQL
WLGPQPFPKSTQHSKKAH
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgggctgcggaaacgcggccggtccggttccgcggcccaggcagagggactc
tgcaagcaatggctgcagcgcgcctggcaagagcggcgcctgctgctgcgggagccgcgc
tacacgctgctggtggccgcctgcctctgcctggcggaggtgggcatcaccttctgggtc
attcacagggtggcatacacagagattgactggaaggcctacatggccgaggtagaaggc
gtcatcaatggtacctatgactatacccaactgcagggtgacaccggaccacttgtgtac
ccagctggtttcgtgtacatctttatggggttgtactatgccaccagccgaggcactgac
atccgcatggcccagaacatctttgctgtgctctacctggctaccttgctgcttgtcttc
ttgatctatcaccagacctgcaaggtacctcccttcgtctttttcttcatgtgctgcgcc
tcttaccgtgtccactccatctttgtgctgcggctcttcaatgacccagtggccatggtg
ctgctcttcctcagtatcaacctcctgctggcccagcgctggggctggggttgctgcttt
ttcagcctggcagtctctgtgaagatgaatgtgctgctcttcgcccctgggttactgttt
cttctcctcacacagtttggcttccgtggggccctccccaagctgggaatctgtgctggc
cttcaggtggtgctggggctgcccttcctgctggagaaccccagcggctacctgtcccgc
tcctttgaccttggccgccagtttctgttccactggacagtgaactggcgcttcctccca
gaggcgctcttcctgcatcgagccttccacctggccctgttgactgcccacctcaccctg
ctcctgctgtttgccctctgcaggtggcacaggacaggggaaagtatcttgtcgctgctg
agggatccctccaaaaggaaggttccaccccagccccttacacccaaccagatcgtttct
accctcttcacctccaacttcattggcatctgcttcagccgctccctccactaccagttc
tacgtctggtatttccacacactgccctacctcctgtgggccatgcctgcacgctggctc
acacacctgctcaggttgttggtgctggggctcatcgagctctcctggaacacataccct
tccacatcctgcagctctgctgccctgcacatatgccatgccgtcatcctgctgcagctc
tggctgggcccgcagcctttccccaagagcacccaacacagcaagaaagcccactga

DBGET integrated database retrieval system