KEGG   Homo sapiens (human): 10213Help
Entry
10213             CDS       T01001                                 

Gene name
PSMD14, PAD1, POH1, RPN11
Definition
(RefSeq) proteasome 26S subunit, non-ATPase 14
  KO
K03030  26S proteasome regulatory subunit N11
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    10213 (PSMD14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    10213 (PSMD14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    10213 (PSMD14)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10213 (PSMD14)
   03051 Proteasome [BR:hsa03051]
    10213 (PSMD14)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M67
   10213 (PSMD14)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    10213 (PSMD14)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     10213 (PSMD14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: JAB MitMem_reg Prok-JAB DUF4525
Motif
Other DBs
NCBI-GeneID: 10213
NCBI-ProteinID: NP_005796
OMIM: 607173
HGNC: 16889
Ensembl: ENSG00000115233
Vega: OTTHUMG00000153882
Pharos: O00487(Tbio)
UniProt: O00487 A0A140VKF2
LinkDB All DBs
Structure
PDB: 

Position
2q24.2
AA seq 310 aa AA seqDB search
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGE
FVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGC
WLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSN
LGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKH
NESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL
AAMLDTVVFK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggacagacttcttagacttggaggaggtatgcctggactgggccaggggccacctaca
gatgctcctgcagtggacacagcagaacaagtctatatctcttccctggcactgttaaaa
atgttaaaacatggccgtgctggagttccaatggaagttatgggtttgatgcttggagaa
tttgttgatgattataccgtcagagtgattgatgtgtttgctatgccacagtcaggaaca
ggtgtcagtgtggaggcagttgatccagtgttccaagctaaaatgttggatatgttgaag
cagacaggaaggccggagatggttgttggttggtatcacagtcaccctggctttggttgt
tggctttctggtgtggatatcaacactcagcagagctttgaagccttgtcggagagagct
gtggcagtggttgtggatcccattcagagtgtaaaaggaaaggttgttattgatgccttc
agattgatcaatgctaatatgatggtcttaggacatgaaccaagacaaacaacttcgaat
ctgggtcacttaaacaagccatctatccaggcattaattcatggactaaacagacattat
tactccattactattaactatcggaaaaatgaactggaacagaagatgttgctaaatttg
cataagaagagttggatggaaggtttgacacttcaggactacagtgaacattgtaaacac
aatgaatcagtggtaaaagagatgttggaattagccaagaattacaataaggctgtagaa
gaagaagataagatgacacctgaacagctggcaataaagaatgttggcaagcaggacccc
aaacgtcatttggaggaacatgtggatgtacttatgacctcaaatattgtccagtgttta
gcagctatgttggatactgtcgtatttaaataa

KEGG   Homo sapiens (human): 11047Help
Entry
11047             CDS       T01001                                 

Gene name
ADRM1, ARM-1, ARM1, GP110
Definition
(RefSeq) adhesion regulating molecule 1
  KO
K06691  26S proteasome regulatory subunit N13
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    11047 (ADRM1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    11047 (ADRM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    11047 (ADRM1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     11047 (ADRM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPN13_C Proteasom_Rpn13 ASXH GerD DUF1631
Motif
Other DBs
NCBI-GeneID: 11047
NCBI-ProteinID: NP_008933
OMIM: 610650
HGNC: 15759
Ensembl: ENSG00000130706
Vega: OTTHUMG00000032904
Pharos: Q16186(Tbio)
UniProt: Q16186
LinkDB All DBs
Structure
PDB: 

Position
20q13.33
AA seq 407 aa AA seqDB search
MTTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFC
WKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEH
CRKVNEYLNNPPMPGALGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGL
GGLGALTGPGLASLLGSSGPPGSSSSSSSRSQSAAVTPSSTTSSTRATPAPSAPAAASAT
SPSPAPSSGNGASTAASPTQPIQLSDLQSILATMNVPAGPAGGQQVDLASVLTPEIMAPI
LANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFG
LPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacgacctcaggcgcgctctttccaagcctggtgccaggctctcggggcgcctccaac
aagtacttggtggagtttcgggcgggaaagatgtccctgaaggggaccaccgtgactccg
gataagcggaaagggctggtgtacattcagcagacggacgactcgcttattcacttctgc
tggaaggacaggacgtccgggaacgtggaagacgacttgatcatcttccctgacgactgt
gagttcaagcgggtgccgcagtgccccagcgggagggtctacgtgctgaagttcaaggca
gggtccaagcggcttttcttctggatgcaggaacccaagacagaccaggatgaggagcat
tgccggaaagtcaacgagtatctgaacaaccccccgatgcctggggcgctgggggccagc
ggaagcagcggccacgaactctctgcgctaggcggtgagggtggcctgcagagcctgctg
ggaaacatgagccacagccagctcatgcagctcatcggaccagccggccttggaggactg
ggtgggctgggggccctgactggacctggcctggccagcttactggggagcagtgggcct
ccagggagcagctcctcctccagctcccggagccagtcggcagcggtcaccccgtcatcc
accacctcttccacccgtgccaccccagccccttctgctccagcagctgcctcagcaact
agcccgagccccgcgcccagttccgggaatggagccagcacagcagccagcccgacccag
cccatccagctgagcgacctccagagcatcctggccacgatgaacgtaccagccgggcca
gcaggcggccagcaagtggacctggccagtgtgctgacgccggagataatggctcccatc
ctcgccaacgcggatgtccaggagcgcctgcttccctacttgccatctggggagtcgctg
ccgcagaccgcggatgagatccagaataccctgacctcgccccagttccagcaggccctg
ggcatgttcagcgcagccttggcctcggggcagctgggccccctcatgtgccagttcggt
ctgcctgcagaggctgtggaggccgccaacaagggcgatgtggaagcgtttgccaaagcc
atgcagaacaacgccaagcccgagcagaaagagggcgacacgaaggacaagaaggacgaa
gaggaggacatgagcctggactga

KEGG   Homo sapiens (human): 5700Help
Entry
5700              CDS       T01001                                 

Gene name
PSMC1, P26S4, S4, p56
Definition
(RefSeq) proteasome 26S subunit, ATPase 1
  KO
K03062  26S proteasome regulatory subunit T2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
nt06130  Cell cycle (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00365  HPV E7 to cell cycle G1/S
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5700 (PSMC1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    5700 (PSMC1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5700 (PSMC1)
   05165 Human papillomavirus infection
    5700 (PSMC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5700 (PSMC1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5700 (PSMC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_2 AAA_22 DUF815 RuvB_N AAA_5 AAA_16 IstB_IS21 AAA_18 AAA_33 AAA_25 ATPase AAA_3 AAA_28 RNA_helicase AAA_14 TIP49 PhoH Mg_chelatase Prot_ATP_OB_N AAA_7 NACHT AAA_11 AAA_24 AAA_30 NB-ARC TsaE ABC_tran Parvo_NS1 Sigma54_activat
Motif
Other DBs
NCBI-GeneID: 5700
NCBI-ProteinID: NP_002793
OMIM: 602706
HGNC: 9547
Ensembl: ENSG00000100764
Vega: OTTHUMG00000171019
Pharos: P62191(Tbio)
UniProt: P62191 Q53XL8
LinkDB All DBs
Structure
PDB: 

Position
14q32.11
AA seq 440 aa AA seqDB search
MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRL
KLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNH
AIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAP
QETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVA
NQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSG
GEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKT
KKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFK
KSKENVLYKKQEGTPEGLYL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaaagtcagagtggtggtcatggtcctggaggtggcaagaaggatgacaaggac
aagaaaaagaaatatgaacctcctgtaccaactagagtggggaaaaagaagaagaaaaca
aagggaccagatgctgccagcaaactgccactggtgacacctcacactcagtgccggtta
aaattactgaagttagagagaattaaagactatcttctcatggaggaagaattcattaga
aatcaggaacaaatgaaaccattagaagaaaagcaagaggaggaaagatcaaaagtggat
gatctgagggggaccccgatgtcagtaggaaccttggaagagatcattgatgacaatcat
gccatcgtgtctacatctgtgggctcagaacactacgtcagcattctttcatttgtagac
aaggatctgctggaacctggctgctcggtcctgctcaaccacaaggtgcatgccgtgata
ggggtgctgatggatgacacggatcccctggtcacagtgatgaaggtagaaaaggccccc
caggagacctatgcagatattggggggttggacaaccaaattcaggaaattaaggaatct
gtggagcttcctctcacccatcctgaatattatgaagagatgggtataaagcctcctaag
ggggtcattctctatggtccacctggcacaggtaaaaccttgttagccaaagcagtagca
aaccaaacctcagccactttcttgagagtggttggctctgaacttattcagaagtaccta
ggtgatgggcccaaactcgtacgggaattgttccgagttgctgaagaacatgcaccgtcc
atcgtgtttattgatgaaattgacgccattgggacaaaaagatatgactccaattctggt
ggtgagagagaaattcagcgaacaatgttggaactgctgaaccagttggatggatttgat
tctaggggagatgtgaaagttatcatggccacaaaccgaatagaaactttggatccagca
cttatcagaccaggccgcattgacaggaagattgagttccccctgcctgatgaaaagacg
aagaagcgcatctttcagattcacacaagcaggatgacgctggctgatgatgtaaccctg
gacgacctgatcatggctaaagatgacctctctggtgctgacatcaaggcaatctgtaca
gaagctggtctgatggccttaagagaacgtagaatgaaagtaacaaatgaagacttcaaa
aaatctaaagaaaatgttctttataagaaacaggaaggcacccctgaggggctgtatctc
taa

KEGG   Homo sapiens (human): 5701Help
Entry
5701              CDS       T01001                                 

Gene name
PSMC2, MSS1, Nbla10058, S7
Definition
(RefSeq) proteasome 26S subunit, ATPase 2
  KO
K03061  26S proteasome regulatory subunit T1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5701 (PSMC2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5701 (PSMC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5701 (PSMC2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5701 (PSMC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA AAA_lid_3 AAA_22 AAA_5 AAA_16 AAA_2 DUF815 RuvB_N AAA_33 AAA_28 AAA_18 AAA_7 Sigma54_activ_2 Mg_chelatase IstB_IS21 TIP49 AAA_24 RNA_helicase AAA_3 AAA_14 Sigma54_activat
Motif
Other DBs
NCBI-GeneID: 5701
NCBI-ProteinID: NP_002794
OMIM: 154365
HGNC: 9548
Ensembl: ENSG00000161057
Vega: OTTHUMG00000157206
Pharos: P35998(Tbio)
UniProt: P35998 A0A140VK70
LinkDB All DBs
Structure
PDB: 

Position
7q22.1
AA seq 433 aa AA seqDB search
MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKIN
ELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAK
FVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGC
KEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRV
IGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTML
ELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHAR
SMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSY
AKFSATPRYMTYN
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgccggattacctcggtgccgatcagcggaagaccaaagaggatgagaaggacgacaag
cccatccgagctctggatgagggggatattgccttgttgaaaacttatggtcagagcact
tactctaggcagatcaagcaagttgaagatgacattcagcaacttctcaagaaaattaat
gagctcactggtattaaagaatctgacactggcctggccccaccagcactctgggatttg
gctgcagataagcagacactccagagtgaacagcctttacaggttgccaggtgtacaaag
ataatcaatgctgattcggaggacccaaaatacattatcaacgtaaagcagtttgccaag
tttgtggtggaccttagtgatcaggtggcacctactgacattgaagaagggatgagagtg
ggcgtggatagaaataaatatcaaattcacattccattgcctcctaagattgacccaaca
gttaccatgatgcaggtggaagagaaacctgatgtcacatacagtgatgttggtggctgt
aaggaacagattgagaaactgcgagaagtagttgaaaccccattacttcatccagagagg
tttgtgaaccttggcattgagcctcccaagggcgtgctgctctttggtccacccggtaca
ggcaagacactctgtgcgcgggcagttgctaatcggactgatgcgtgcttcattcgagtt
attggatctgagcttgtacagaaatacgtcggtgagggggctcgaatggttcgtgaactc
tttgaaatggccagaacaaaaaaagcctgccttatcttctttgatgaaattgatgctatt
ggaggggctcgttttgatgatggtgctggaggtgacaatgaagtgcagagaacaatgttg
gaactgatcaatcagcttgatggttttgatcctagaggcaatattaaagtgctgatggcc
actaacagacctgatactttggatccagcactgatgaggccagggagattggatagaaaa
attgaatttagcttgcccgatctagagggtcggacccacatatttaagattcacgctcgt
tcaatgagtgttgaaagagatatcagatttgaactgttagcacgactgtgtccaaatagc
actggtgctgagattagaagcgtctgcacagaggctggtatgtttgccatcagagcacgg
cgaaaaattgctaccgagaaggatttcttggaagctgtaaataaggtcattaagtcttat
gccaaattcagtgctactcctcgttacatgacatacaactga

KEGG   Homo sapiens (human): 5702Help
Entry
5702              CDS       T01001                                 

Gene name
PSMC3, TBP1
Definition
(RefSeq) proteasome 26S subunit, ATPase 3
  KO
K03065  26S proteasome regulatory subunit T5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5702 (PSMC3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5702 (PSMC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5702 (PSMC3)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5702 (PSMC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA Prot_ATP_ID_OB AAA_lid_3 AAA_5 AAA_16 RuvB_N AAA_2 AAA_22 AAA_33 DUF815 PhoH Mg_chelatase AAA_11 Sigma54_activat IstB_IS21 JIP_LZII ATPase AAA_24 DUF3713 AAA_7 RNA_helicase
Motif
Other DBs
NCBI-GeneID: 5702
NCBI-ProteinID: NP_002795
OMIM: 186852
HGNC: 9549
Ensembl: ENSG00000165916
Vega: OTTHUMG00000167692
Pharos: P17980(Tbio)
UniProt: P17980 A0A140VK42
LinkDB All DBs
Structure
PDB: 

Position
11p11.2
AA seq 439 aa AA seqDB search
MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVL
RVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGK
CAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDER
PTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARAC
AAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEK
AGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEE
ARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDY
MEGILEVQAKKKANLQYYA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgctgccgaatattgagagtccagtgactcggcaggagaagatggcgaccgtg
tgggatgaggccgagcaagatggaattggggaggaggtgctcaagatgtccacggaggag
atcatccagcgcacacggctgctggacagtgagatcaagatcatgaagagtgaagtgttg
agagtcacccatgagctccaagccatgaaggacaagataaaagagaacagtgagaaaatc
aaagtgaacaagaccctgccgtaccttgtctccaacgtcatcgagctcctggatgttgat
cctaatgaccaagaggaggatggtgccaatattgacctggactcccagaggaagggcaag
tgtgctgtgatcaaaacctctacacgacagacgtacttccttcctgtgattgggttggtg
gatgctgaaaagctaaagccaggagacctggtgggtgtgaacaaagactcctatctgatc
ctggagacgctgcccacagagtatgactcgcgggtgaaggccatggaggtagacgagagg
cccacggagcaatacagtgacattgggggtttggacaagcagatccaggagctggtggag
gccattgtcttgccaatgaaccacaaggagaagtttgagaacttggggatccaacctcca
aaaggggtgctgatgtatgggcccccagggacggggaagaccctcctggcccgggcctgt
gccgcacagactaaggccaccttcctaaagctggctggcccccagctggtgcagatgttc
attggagatggtgccaagctagtccgggatgcctttgccctggccaaggagaaagcgccc
tctatcatcttcattgatgagttggatgccatcggcaccaagcgctttgacagtgagaag
gctggggaccgggaggtgcagaggacaatgctggagcttctgaaccagctggatggcttc
cagcccaacacccaagttaaggtaattgcagccacaaacagggtggacatcctggacccc
gccctcctccgctcgggccgccttgaccgcaagatagagttcccgatgcccaatgaggag
gcccgggccagaatcatgcagatccactcccgaaagatgaatgtcagtcctgacgtgaac
tacgaggagctggcccgctgcacagatgacttcaatggggcccagtgcaaggctgtgtgt
gtggaggcgggcatgatcgcactgcgcaggggtgccacggagctcacccacgaggactac
atggaaggcatcctggaggtgcaggccaagaagaaagccaacctacaatactacgcctag

KEGG   Homo sapiens (human): 5704Help
Entry
5704              CDS       T01001                                 

Gene name
PSMC4, MIP224, RPT3, S6, TBP-7, TBP7
Definition
(RefSeq) proteasome 26S subunit, ATPase 4
  KO
K03063  26S proteasome regulatory subunit T3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5704 (PSMC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5704 (PSMC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5704 (PSMC4)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5704 (PSMC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA Prot_ATP_ID_OB AAA_lid_3 AAA_2 AAA_5 AAA_16 RuvB_N DUF815 AAA_22 RNA_helicase NTPase_1 Mg_chelatase AAA_14 AAA_28 AAA_18 IstB_IS21 AAA_33 Sigma54_activat NACHT TIP49 CENP-F_leu_zip AAA_3 TsaE ATPase_2 AAA_7 AAA_24 AAA_25 DUF3450 Zeta_toxin NB-ARC Parvo_NS1 AAA_17 ABC_tran DivIVA AAA_30
Motif
Other DBs
NCBI-GeneID: 5704
NCBI-ProteinID: NP_006494
OMIM: 602707
HGNC: 9551
Ensembl: ENSG00000013275
Vega: OTTHUMG00000182577
Pharos: P43686(Tbio)
UniProt: P43686 A8K2M0
LinkDB All DBs
Structure
PDB: 

Position
19q13.2
AA seq 418 aa AA seqDB search
MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEY
IKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTID
RELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREA
VELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYL
GEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFD
QNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDL
EDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggaggagataggcatcttggtggagaaggctcaggatgagatcccagcactgtccgtg
tcccggccccagaccggcctgtccttcctgggccctgagcctgaggacctggaggacctg
tacagccgctacaagaagctgcagcaagagctggagttcctggaggtgcaggaggaatac
atcaaagatgagcaaaagaacctgaaaaaggaatttctccatgcccaggaggaggtgaag
cgaatccaaagcatcccgctggtcatcggacaatttctggaggctgtggatcagaataca
gccatcgtgggctctaccacaggctccaactattatgtgcgcatcctgagcaccatcgat
cgggagctgctcaagcccaacgcctcagtggccctccacaagcacagcaatgcactggtg
gacgtgctgccccccgaagccgacagcagcatcatgatgctcacctcagaccagaagcca
gatgtgatgtacgcggacatcggaggcatggacatccagaagcaggaggtgcgggaggcc
gtggagctcccgctcacgcatttcgagctctacaagcagatcggcatcgatcccccccga
ggcgtcctcatgtatggcccacctggctgtgggaagaccatgttggcaaaggcggtggca
catcacacaacagctgcattcatccgggtcgtgggctcggagtttgtacagaagtatctg
ggtgagggcccccgcatggtccgggatgtgttccgcctggccaaggagaatgcacctgcc
atcatcttcatagacgagattgatgccatcgccaccaagagattcgatgctcagacaggg
gccgacagggaggttcagaggatcctgctggagctgctgaatcagatggatggatttgat
cagaatgtcaatgtcaaggtaatcatggccacaaacagagcagacaccctggatccggcc
ctgctacggccaggacggctggaccgtaaaattgaatttccacttcctgaccgccgccag
aagagattgattttctccactatcactagcaagatgaacctctctgaggaggttgacttg
gaagactatgtggcccggccagataagatttcaggagctgatattaactccatctgtcag
gagagtggaatgttggctgtccgtgaaaaccgctacattgtcctggccaaggacttcgag
aaagcatacaagactgtcatcaagaaggacgagcaggagcatgagttttacaagtga

KEGG   Homo sapiens (human): 5705Help
Entry
5705              CDS       T01001                                 

Gene name
PSMC5, S8, SUG-1, SUG1, TBP10, TRIP1, p45, p45/SUG
Definition
(RefSeq) proteasome 26S subunit, ATPase 5
  KO
K03066  26S proteasome regulatory subunit T6
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5705 (PSMC5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5705 (PSMC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5705 (PSMC5)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5705 (PSMC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA AAA_lid_3 AAA_2 Prot_ATP_ID_OB AAA_5 AAA_16 AAA_22 RuvB_N TIP49 AAA_33 IstB_IS21 AAA_18 AAA_3 Mg_chelatase PhoH ATPase AAA_28 RILP Sigma54_activat AAA_7 AAA_24 TsaE Parvo_NS1 AAA_14 AAA_25 DUF815 AAA_17 RNA_helicase AAA_11 Zeta_toxin AAA_19 DivIC
Motif
Other DBs
NCBI-GeneID: 5705
NCBI-ProteinID: NP_002796
OMIM: 601681
HGNC: 9552
Ensembl: ENSG00000087191
Vega: OTTHUMG00000179013
Pharos: P62195(Tbio)
UniProt: P62195 A0A140VJS3
LinkDB All DBs
Structure
PDB: 

Position
17q23.3
AA seq 406 aa AA seqDB search
MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLR
EELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDS
YTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGI
AQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMARE
HAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDI
LDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVK
GVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttgacggaccagagcagatggagctggaggaggggaaggcaggcagcggactc
cgccaatattatctgtccaagattgaagaactccagctgattgtgaatgataagagccaa
aacctccggaggctgcaggcacagaggaacgaactaaatgctaaagttcgcctattgcgg
gaggagctacagctgctgcaggagcagggctcctatgtgggggaagtagtccgggccatg
gataagaagaaagtgttggtcaaggtacatcctgaaggtaaatttgttgtagacgtggac
aaaaacattgacatcaatgatgtgacacccaattgccgggtggctctaaggaatgacagc
tacactctgcacaagatcctgcccaacaaggtagacccattagtgtcactgatgatggtg
gagaaagtaccagattcaacttatgagatgattggtggactggacaaacagatcaaggag
atcaaagaagtgatcgagctgcctgttaagcatcctgagctcttcgaagcactgggcatt
gctcagcccaagggagtgctgctgtatggacctccaggcactgggaagacactgttggcc
cgggctgtggctcatcatacggactgtacctttattcgtgtctctggctctgaactggta
cagaaattcataggggaaggggcaagaatggtgagggagctgtttgtcatggcacgggaa
catgctccatctatcatcttcatggacgaaatcgactccatcggctcctcgcggctggag
gggggttctggaggggacagtgaagtgcagcgcacgatgctggagttgctcaaccagctc
gacggctttgaggccaccaagaacatcaaggttatcatggctactaataggattgatatc
ctggactcggcactgcttcgcccagggcgcattgacagaaaaattgaattcccacccccc
aatgaggaggcccggctggacattttgaagattcattctcggaagatgaacctgacccgg
gggatcaacctgagaaaaattgctgagctcatgccaggagcatcaggggctgaagtgaag
ggcgtgtgcacagaagctggcatgtatgccctgcgagaacggcgagtccatgtcactcag
gaggactttgagatggcagtagccaaggtcatgcagaaggacagtgagaaaaacatgtcc
atcaagaaattatggaagtga

KEGG   Homo sapiens (human): 5706Help
Entry
5706              CDS       T01001                                 

Gene name
PSMC6, SUG2, p42
Definition
(RefSeq) proteasome 26S subunit, ATPase 6
  KO
K03064  26S proteasome regulatory subunit T4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5706 (PSMC6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5706 (PSMC6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5706 (PSMC6)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5706 (PSMC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_16 AAA_5 AAA_2 AAA_22 RuvB_N AAA_18 Prot_ATP_OB_N AAA_33 AAA_7 DUF815 AAA_3 AAA_14 TsaE IstB_IS21 RNA_helicase TIP49 Mg_chelatase AAA_11 AAA_24 TPR_MLP1_2 ATPase NACHT AAA_25 GAS AAA_28 DUF4140 Med4
Motif
Other DBs
NCBI-GeneID: 5706
NCBI-ProteinID: NP_002797
OMIM: 602708
HGNC: 9553
Ensembl: ENSG00000100519
Vega: OTTHUMG00000152333
Pharos: P62333(Tbio)
UniProt: P62333 A0A087X2I1
LinkDB All DBs
Structure
PDB: 

Position
14q22.1
AA seq 389 aa AA seqDB search
MADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEV
LKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVY
NMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGK
TLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGG
RRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIH
IDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHD
FVVQEDFMKAVRKVADSKKLESKLDYKPV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccctagagataaggcgcttcaggactaccgcaagaagttgcttgaacacaag
gagatcgacggccgtcttaaggagttaagggaacaattaaaagaacttaccaagcagtat
gaaaagtctgaaaatgatctgaaggccctacagagtgttgggcagatcgtgggtgaagtg
cttaaacagttaactgaagaaaaattcattgttaaagctaccaatggaccaagatatgtt
gtgggttgtcgtcgacagcttgacaaaagtaagctgaagccaggaacaagagttgctttg
gatatgactacactaactatcatgagatatttgccgagagaggtggatccactggtttat
aacatgtctcatgaggaccctgggaatgtttcttattctgagattggagggctatcagaa
cagatccgggaattaagagaggtgatagaattacctcttacaaacccagagttatttcag
cgtgtaggaataatacctccaaaaggctgtttgttatatggaccaccaggtacgggaaaa
acactcttggcacgagccgttgctagccagctggactgcaatttcttaaaggttgtatct
agttctattgtagacaagtacattggtgaaagtgctcgtttgatcagagaaatgtttaat
tatgctagagatcatcaaccatgcatcatttttatggatgaaatagatgctattggtggt
cgtcggttttctgagggtacttcagctgacagagagattcagagaacgttaatggagtta
ctgaatcaaatggatggatttgatactctgcatagagttaaaatgatcatggctacaaac
agaccagatacactggatcctgctttgctgcgtccaggaagattagatagaaaaatacat
attgatttgccaaatgaacaagcaagattagacatactgaaaatccatgcaggtcccatt
acaaagcatggtgaaatagattatgaagcaattgtgaagctttcggatggctttaatgga
gcagatctgagaaatgtttgtactgaagcaggtatgttcgcaattcgtgctgatcatgat
tttgtagtacaggaagacttcatgaaagcagtcagaaaagtggctgattctaagaagctg
gagtctaaattggactacaaacctgtgtaa

KEGG   Homo sapiens (human): 5707Help
Entry
5707              CDS       T01001                                 

Gene name
PSMD1, P112, Rpn2, S1
Definition
(RefSeq) proteasome 26S subunit, non-ATPase 1
  KO
K03032  26S proteasome regulatory subunit N2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5707 (PSMD1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5707 (PSMD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5707 (PSMD1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     5707 (PSMD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPN2_C PC_rep HEAT_2 RPN1_RPN2_N HEAT_EZ PA26 Tim54
Motif
Other DBs
NCBI-GeneID: 5707
NCBI-ProteinID: NP_002798
OMIM: 617842
HGNC: 9554
Ensembl: ENSG00000173692
Vega: OTTHUMG00000133223
Pharos: Q99460(Tbio)
UniProt: Q99460
LinkDB All DBs
Structure
PDB: 

Position
2q37.1
AA seq 953 aa AA seqDB search
MITSAAGIISLLDEDEPQLKEFALHKLNAVVNDFWAEISESVDKIEVLYEDEGFRSRQFA
ALVASKVFYHLGAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTKQCVENADLPE
GEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALETRRLDVFEKTILESNDVPGMLAYS
LKLCMSLMQNKQFRNKVLRVLVKIYMNLEKPDFINVCQCLIFLDDPQAVSDILEKLVKED
NLLMAYQICFDLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGSEKDSDSMETE
EKTSSAFVGKTPEASPEPKDQTLKMIKILSGEMAIELHLQFLIRNNNTDLMILKNTKDAV
RNSVCHTATVIANSFMHCGTTSDQFLRDNLEWLARATNWAKFTATASLGVIHKGHEKEAL
QLMATYLPKDTSPGSAYQEGGGLYALGLIHANHGGDIIDYLLNQLKNASNDIVRHGGSLG
LGLAAMGTARQDVYDLLKTNLYQDDAVTGEAAGLALGLVMLGSKNAQAIEDMVGYAQETQ
HEKILRGLAVGIALVMYGRMEEADALIESLCRDKDPILRRSGMYTVAMAYCGSGNNKAIR
RLLHVAVSDVNDDVRRAAVESLGFILFRTPEQCPSVVSLLSESYNPHVRYGAAMALGICC
AGTGNKEAINLLEPMTNDPVNYVRQGALIASALIMIQQTEITCPKVNQFRQLYSKVINDK
HDDVMAKFGAILAQGILDAGGHNVTISLQSRTGHTHMPSVVGVLVFTQFWFWFPLSHFLS
LAYTPTCVIGLNKDLKMPKVQYKSNCKPSTFAYPAPLEVPKEKEKEKVSTAVLSITAKAK
KKEKEKEKKEEEKMEVDEAEKKEEKEKKKEPEPNFQLLDNPARVMPAQLKVLTMPETCRY
QPFKPLSIGGIIILKDTSEDIEELVEPVAAHGPKIEEEEQEPEPPEPFEYIDD
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgatcacctcggccgctggaattatttctcttctggatgaagatgaaccacagcttaag
gaatttgcactacacaaattgaatgcagttgttaatgacttctgggcagaaatttccgag
tccgtagacaaaatagaggttttatacgaagatgaaggtttccggagtcggcagtttgca
gccttagtggcatctaaagtattttatcacctgggggcttttgaggagtctctgaattat
gctcttggagcaggggacctcttcaatgtcaatgataactctgaatatgtggaaactatt
atagcaaaatgcattgatcactacaccaaacaatgtgtggaaaatgcagatttgcctgaa
ggagaaaaaaaaccaattgaccagagattggaaggcatcgtaaataaaatgttccagcga
tgtctagatgatcacaagtataaacaggctattggcattgctctggagacacgaagactg
gacgtctttgaaaagaccatactggagtcgaatgatgtcccaggaatgttagcttatagc
cttaagctctgcatgtctttaatgcagaataaacagtttcggaataaagtactaagagtt
ctagttaaaatctacatgaacttggagaaacctgatttcatcaatgtttgtcagtgctta
attttcttagatgatcctcaggctgtgagtgatatcttagagaaactggtaaaggaagac
aacctcctgatggcatatcagatttgttttgatttgtatgaaagtgctagccagcagttt
ttgtcatctgtaatccagaatcttcgaactgttggcacccctattgcttctgtgcctgga
tccactaatacgggtactgttccgggatcagagaaagacagtgactcgatggaaacagaa
gaaaagacaagcagtgcatttgtaggaaagacaccagaagccagtccagagcctaaggac
cagactttgaaaatgattaaaattttaagtggtgaaatggctattgagttacatctgcag
ttcttaatacgaaacaataatacagacctcatgattctaaaaaacacaaaggatgcagta
cggaattctgtatgtcatactgcaaccgttatagcaaactcttttatgcactgtgggaca
accagtgaccagtttcttagagataatttggaatggttagccagagccactaactgggca
aaatttactgctacagccagtttgggtgtaattcataagggtcatgaaaaagaagcatta
cagttaatggcaacataccttcccaaggatacttctccaggatcagcctatcaggaaggt
ggaggtctctatgcactaggtcttattcatgccaatcatggtggtgatataattgactat
ctgcttaatcagcttaagaacgccagcaatgatatcgttagacacggtggcagtctgggc
cttggtttggcagccatgggaactgcacgtcaagatgtttatgatttgctaaaaacaaac
ctttatcaggatgatgcagtaacaggggaagcagctggcctggccctaggtttggttatg
ttgggctctaaaaatgctcaggctattgaggacatggttggttatgcacaagaaactcaa
catgagaagattctgcgtggtcttgcagttggcatagctttagtaatgtatgggaggatg
gaagaggctgatgctctcattgaatctctctgtcgtgacaaggacccaattcttcgaagg
tctggaatgtatactgtagccatggcttattgtggctctggtaacaacaaagcaattcga
cgcctgctacatgttgctgtaagtgatgttaatgatgatgtcaggagggcagcagtagaa
tcacttgggttcattctattcagaacccctgaacagtgcccaagtgttgtctctttgttg
tcagagagttacaaccctcatgtgcgctacggagctgcaatggccttggggatatgctgt
gctggtacaggaaacaaggaagccattaatttgctagaaccaatgacaaacgaccccgtg
aactacgtgaggcaaggggcactcatagcttcagctctcatcatgatccagcagactgaa
atcacttgtccaaaggtgaatcagttcagacagctgtattccaaagtcatcaatgataag
catgatgatgtcatggccaagtttggcgctattctggcccagggcatactggatgcaggt
ggtcataatgtcacaatctccttgcagtccaggactgggcatactcatatgccttctgtg
gttggcgtccttgtatttacccagttttggttctggtttcctctttcacacttcctgtca
ttggcttatacccctacctgtgtcattggccttaacaaggacttaaagatgccgaaagtt
cagtataaatcgaactgtaaaccatccacatttgcatatcctgcccctctggaagtacca
aaagaaaaagaaaaggaaaaggtttctactgctgtattatctataactgccaaggctaaa
aagaaggaaaaagaaaaggaaaaaaaggaggaggagaaaatggaagtggatgaggcagag
aaaaaggaggaaaaagagaagaaaaaagaacctgagccaaacttccagttattggataac
ccagcccgagttatgcctgcccagcttaaggtcctaaccatgccggagacctgtagatac
cagcctttcaaaccactctctattggaggcatcatcattctgaaggataccagtgaagac
attgaggagctggtggaacctgtggcagcacatggcccaaaaatcgaggaggaggaacaa
gagccagaacccccagaaccatttgagtatattgatgattaa

KEGG   Homo sapiens (human): 5708Help
Entry
5708              CDS       T01001                                 

Gene name
PSMD2, P97, RPN1, S2, TRAP2
Definition
(RefSeq) proteasome 26S subunit, non-ATPase 2
  KO
K03028  26S proteasome regulatory subunit N1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5708 (PSMD2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5708 (PSMD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5708 (PSMD2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     5708 (PSMD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPN1_RPN2_N RPN1_C PC_rep HEAT_2 THAP
Motif
Other DBs
NCBI-GeneID: 5708
NCBI-ProteinID: NP_002799
OMIM: 606223
HGNC: 9559
Ensembl: ENSG00000175166
Vega: OTTHUMG00000156796
Pharos: Q13200(Tbio)
UniProt: Q13200
LinkDB All DBs
Structure
PDB: 

Position
3q27.1
AA seq 908 aa AA seqDB search
MEEGGRDKAPVQPQQSPAAAPGGTDEKPSGKERRDAGDKDKEQELSEEDKQLQDELEMLV
ERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKR
FAADIISVLAMTMSGERECLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELDDAEKVQ
REPLLTLVKEIVPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYAKVCLYLTSCVNYV
PEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGR
HGVFLELSEDVEEYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGG
SGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKDHGMLSAAASLGMILLW
DVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLG
SIFGLGLAYAGSNREDVLTLLLPVMGDSKSSMEVAGVTALACGMIAVGSCNGDVTSTILQ
TIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAY
AGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALI
AMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPE
VSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCP
YHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPL
PVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVIL
RKNPNYDL
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atggaggagggaggccgggacaaggcgccggtgcagccccagcagtctccagcggcggcc
cccggcggcacggacgagaagccgagcggcaaggagcggcgggatgccggggacaaggac
aaagaacaggagctgtctgaagaggataaacagcttcaagatgaactggagatgctcgtg
gaacgactaggggagaaggatacatccctgtatcgaccagcgctggaggaattgcgaagg
cagattcgttcttctacaacttccatgacttcagtgcccaagcctctcaaatttctgcgt
ccacactatggcaaactgaaggaaatctatgagaacatggcccctggggagaataagcgt
tttgctgctgacatcatctccgttttggccatgaccatgagtggggagcgtgagtgcctc
aagtatcggctagtgggctcccaggaggaattggcatcatggggtcatgagtatgtcagg
catctggcaggagaagtggctaaggagtggcaggagctggatgacgcagagaaggtccag
cgggagcctctgctcactctggtgaaggaaatcgtcccctataacatggcccacaatgca
gagcatgaggcttgcgacctgcttatggaaattgagcaggtggacatgctggagaaggac
attgatgaaaatgcatatgcaaaggtctgcctttatctcaccagttgtgtgaattacgtg
cctgagcctgagaactcagccctactgcgttgtgccctgggtgtgttccgaaagtttagc
cgcttccctgaagctctgagattggcattgatgctcaatgacatggagttggtagaagac
atcttcacctcctgcaaggatgtggtagtacagaaacagatggcattcatgctaggccgg
catggggtgttcctggagctgagtgaagatgtcgaggagtatgaggacctgacagagatc
atgtccaatgtacagctcaacagcaacttcttggccttagctcgggagctggacatcatg
gagcccaaggtgcctgatgacatctacaaaacccacctagagaacaacaggtttgggggc
agtggctctcaggtggactctgcccgcatgaacctggcctcctcttttgtgaatggcttt
gtgaatgcagcttttggccaagacaagctgctaacagatgatggcaacaaatggctttac
aagaacaaggaccacggaatgttgagtgcagctgcatctcttgggatgattctgctgtgg
gatgtggatggtggcctcacccagattgacaagtacctgtactcctctgaggactacatt
aagtcaggagctcttcttgcctgtggcatagtgaactctggggtccggaatgagtgtgac
cctgctctggcactgctctcagactatgttctccacaacagcaacaccatgagacttggt
tccatctttgggctaggcttggcttatgctggctcaaatcgtgaagatgtcctaacactg
ctgctgcctgtgatgggagattcaaagtccagcatggaggtggcaggtgtcacagcttta
gcctgtggaatgatagcagtagggtcctgcaatggagatgtaacttccactatccttcag
accatcatggagaagtcagagactgagctcaaggatacttatgctcgttggcttcctctt
ggactgggtctcaaccacctggggaagggtgaggccatcgaggcaatcctggctgcactg
gaggttgtgtcagagccattccgcagttttgccaacacactggtggatgtgtgtgcatat
gcaggctctgggaatgtgctgaaggtgcagcagctgctccacatttgtagcgaacacttt
gactccaaagagaaggaggaagacaaagacaagaaggaaaagaaagacaaggacaagaag
gaagcccctgctgacatgggagcacatcagggagtggctgttctggggattgcccttatt
gctatgggggaggagattggtgcagagatggcattacgaacctttggccacttgctgaga
tatggggagcctacactccggagggctgtacctttagcactggccctcatctctgtttca
aatccacgactcaacatcctggataccctaagcaaattctctcatgatgctgatccagaa
gtttcctataactccatttttgccatgggcatggtgggcagtggtaccaataatgcccgt
ctggctgcaatgctgcgccagttagctcaatatcatgccaaggacccaaacaacctcttc
atggtgcgcttggcacagggcctgacacatttagggaagggcacccttaccctctgcccc
taccacagcgaccggcagcttatgagccaggtggccgtggctggactgctcactgtgctt
gtctctttcctggatgttcgaaacattattctaggcaaatcacactatgtattgtatggg
ctggtggctgccatgcagccccgaatgctggttacgtttgatgaggagctgcggccattg
ccagtgtctgtccgtgtgggccaggcagtggatgtggtgggccaggctggcaagccgaag
actatcacagggttccagacgcatacaaccccagtgttgttggcccacggggaacgggca
gaattggccactgaggagtttcttcctgttacccccattctggaaggttttgttatcctt
cggaagaaccccaattatgatctctaa

KEGG   Homo sapiens (human): 5709Help
Entry
5709              CDS       T01001                                 

Gene name
PSMD3, P58, RPN3, S3, TSTA2
Definition
(RefSeq) proteasome 26S subunit, non-ATPase 3
  KO
K03033  26S proteasome regulatory subunit N3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5709 (PSMD3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5709 (PSMD3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5709 (PSMD3)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     5709 (PSMD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rpn3_C PCI CSN8_PSD8_EIF3K TSKS TPR_2
Motif
Other DBs
NCBI-GeneID: 5709
NCBI-ProteinID: NP_002800
OMIM: 617676
HGNC: 9560
Ensembl: ENSG00000108344
Vega: OTTHUMG00000133251
Pharos: O43242(Tbio)
UniProt: O43242
LinkDB All DBs
Structure
PDB: 

Position
17q21.1
AA seq 534 aa AA seqDB search
MKQEGSARRRGADKAKPPPGGGEQEPPPPPAPQDVEMKEEAATGGGSTGEADGKTAAAAA
EHSQRELDTVTLEDIKEHVKQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVQGF
FTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAASTPLLPEVEAYLQLLVVIFMMNSKR
YKEAQKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATL
RHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQL
EYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPY
FLLTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLA
DIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRI
SFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaggagggctcggcgcggcgccgcggcgcggacaaggcgaaaccgccgcccggc
ggaggagaacaagaacccccaccgccgccggccccccaggatgtggagatgaaagaggag
gcagcgacgggtggcgggtcgacgggggaggcagacggcaagacggcggcggcagcggct
gagcactcccagcgagagctggacacagtcaccttggaggacatcaaggagcacgtgaaa
cagctagagaaagcggtttcaggcaaggagccgagattcgtgctgcgggccctgcggatg
ctgccttccacatcacgccgcctcaaccactatgttctgtataaggctgtgcagggcttc
ttcacttcaaataatgccactcgagactttttgctccccttcctggaagagcccatggac
acagaggctgatttacagttccgtccccgcacgggaaaagctgcgtcgacacccctcctg
cctgaagtggaagcctatctccaactcctcgtggtcatcttcatgatgaacagcaagcgc
tacaaagaggcacagaagatctctgatgatctgatgcagaagatcagtactcagaaccgc
cgggccctagaccttgtagccgcaaagtgttactattatcacgcccgggtctatgagttc
ctggacaagctggatgtggtgcgcagcttcttgcatgctcggctccggacagctacgctt
cggcatgacgcagacgggcaggccaccctgttgaacctcctgctgcggaattacctacac
tacagcttgtacgaccaggctgagaagctggtgtccaagtctgtgttcccagagcaggcc
aacaacaatgagtgggccaggtacctctactacacagggcgaatcaaagccatccagctg
gagtactcagaggcccggagaacgatgaccaacgcccttcgcaaggcccctcagcacaca
gctgtcggcttcaaacagacggtgcacaagcttctcatcgtggtggagctgttgctgggg
gagatccctgaccggctgcagttccgccagccctccctcaagcgctcactcatgccctat
ttccttctgactcaagctgtcaggacaggaaacctagccaagttcaaccaggtcctggat
cagtttggggagaagtttcaagcagatgggacctacaccctaattatccggctgcggcac
aacgtgattaagacaggtgtacgcatgatcagcctctcctattcccgaatctccttggct
gacatcgcccagaagctgcagttggatagccccgaagatgcagagttcattgttgccaag
gccatccgggatggtgtcattgaggccagcatcaaccacgagaagggctatgtccaatcc
aaggagatgattgacatctattccacccgagagccccagctagccttccaccagcgcatc
tccttctgcctagatatccacaacatgtctgtcaaggccatgaggtttcctcccaaatcg
tacaacaaggacttggagtctgcagaggaacggcgtgagcgagaacagcaggacttggag
tttgccaaggagatggcagaagatgatgatgacagcttcccttga

KEGG   Homo sapiens (human): 5710Help
Entry
5710              CDS       T01001                                 

Gene name
PSMD4, AF, AF-1, ASF, MCB1, Rpn10, S5A, pUB-R5
Definition
(RefSeq) proteasome 26S subunit, non-ATPase 4
  KO
K03029  26S proteasome regulatory subunit N10
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5710 (PSMD4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5710 (PSMD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5710 (PSMD4)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     5710 (PSMD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWA_2 VWA Ssl1 UIM RAP80_UIM
Motif
Other DBs
NCBI-GeneID: 5710
NCBI-ProteinID: NP_002801
OMIM: 601648
HGNC: 9561
Ensembl: ENSG00000159352
Vega: OTTHUMG00000012349
Pharos: P55036(Tbio)
UniProt: P55036
LinkDB All DBs
Structure
PDB: 

Position
1q21.3
AA seq 377 aa AA seqDB search
MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEV
LTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDN
EKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLA
DALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAA
ASAAEAGIATTGTEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEF
GQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLA
SQATKDGKKDKKEEDKK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggtgttggaaagcactatggtgtgtgtggacaacagtgagtatatgcggaatggagac
ttcttacccaccaggctgcaggcccagcaggatgctgtcaacatagtttgtcattcaaag
acccgcagcaaccctgagaacaacgtgggccttatcacactggctaatgactgtgaagtg
ctgaccacactcaccccagacactggccgtatcctgtccaagctacatactgtccaaccc
aagggcaagatcaccttctgcacgggcatccgcgtggcccatctggctctgaagcaccga
caaggcaagaatcacaagatgcgcatcattgcctttgtgggaagcccagtggaggacaat
gagaaggatctggtgaaactggctaaacgcctcaagaaggagaaagtaaatgttgacatt
atcaattttggggaagaggaggtgaacacagaaaagctgacagcctttgtaaacacgttg
aatggcaaagatggaaccggttctcatctggtgacagtgcctcctgggcccagtttggct
gatgctctcatcagttctccgattttggctggtgaaggtggtgccatgctgggtcttggt
gccagtgactttgaatttggagtagatcccagtgctgatcctgagctggccttggccctt
cgtgtatctatggaagagcagcggcagcggcaggaggaggaggcccggcgggcagctgca
gcttctgctgctgaggccgggattgctacgactgggactgaagactcagacgatgccctg
ctgaagatgaccatcagccagcaagagtttggccgcactgggcttcctgacctaagcagt
atgactgaggaagagcagattgcttatgccatgcagatgtccctgcagggagcagagttt
ggccaggcggaatcagcagacattgatgccagctcagctatggacacatctgagccagcc
aaggaggaggatgattacgacgtgatgcaggaccccgagttccttcagagtgtcctagag
aacctcccaggtgtggatcccaacaatgaagccattcgaaatgctatgggctccctggcc
tcccaggccaccaaggacggcaagaaggacaagaaggaggaagacaagaagtga

KEGG   Homo sapiens (human): 5713Help
Entry
5713              CDS       T01001                                 

Gene name
PSMD7, MOV34, P40, Rpn8, S12
Definition
(RefSeq) proteasome 26S subunit, non-ATPase 7
  KO
K03038  26S proteasome regulatory subunit N8
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5713 (PSMD7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5713 (PSMD7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5713 (PSMD7)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     5713 (PSMD7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MitMem_reg JAB Coilin_N Connexin
Motif
Other DBs
NCBI-GeneID: 5713
NCBI-ProteinID: NP_002802
OMIM: 157970
HGNC: 9565
Ensembl: ENSG00000103035
Vega: OTTHUMG00000137601
Pharos: P51665(Tbio)
UniProt: P51665
LinkDB All DBs
Structure
PDB: 

Position
16q23.1
AA seq 324 aa AA seqDB search
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDV
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKDR
KEDKEKDKDKEKSDVKKEEKKEKK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgccggagctggcagtgcagaaggtggtggtccaccccctggtgctgctcagtgtggtg
gatcatttcaaccgaatcggcaaggttggaaaccagaagcgtgttgttggtgtgcttttg
gggtcatggcaaaagaaagtacttgatgtatcgaacagttttgcagttccttttgatgaa
gatgacaaagacgattctgtatggtttttagaccatgattatttggaaaacatgtatgga
atgtttaagaaagtcaatgccagggaaagaatagttggctggtaccacacaggccctaaa
ctacacaagaatgacattgccatcaacgaactcatgaaaagatactgtcctaattccgta
ttggtcatcattgatgtgaagccgaaggacctagggctgcctacagaagcgtacatttca
gtggaagaagtccatgatgatggaactccaacctcgaaaacatttgaacacgtgaccagt
gaaattggagcagaggaagctgaggaagttggagttgaacacttgttacgagatatcaaa
gacacgacggtgggcactctgtcccagcggatcacaaaccaggtccatggtttgaaggga
ctgaactccaagcttctggatatcaggagctacctggaaaaagtcgccacaggcaagctg
cccatcaaccaccagatcatctaccagctgcaggacgtcttcaacctgctgccagatgtc
agcctgcaggagttcgtcaaggccttttacctgaagaccaatgaccagatggtggtagtg
tacttggcctcgctgatccgttccgtggtcgccctgcacaacctcatcaacaacaagatt
gccaaccgggatgcagagaagaaagaagggcaggagaaagaagagagcaaaaaggatagg
aaagaggacaaggagaaagataaagataaggaaaagagtgatgtaaagaaagaggagaaa
aaggagaaaaagtaa

KEGG   Homo sapiens (human): 5714Help
Entry
5714              CDS       T01001                                 

Gene name
PSMD8, HEL-S-91n, HIP6, HYPF, Nin1p, Rpn12, S14, p31
Definition
(RefSeq) proteasome 26S subunit, non-ATPase 8
  KO
K03031  26S proteasome regulatory subunit N12
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5714 (PSMD8)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5714 (PSMD8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5714 (PSMD8)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     5714 (PSMD8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CSN8_PSD8_EIF3K
Motif
Other DBs
NCBI-GeneID: 5714
NCBI-ProteinID: NP_002803
OMIM: 617844
HGNC: 9566
Ensembl: ENSG00000099341
Vega: OTTHUMG00000150691
Pharos: P48556(Tbio)
UniProt: P48556 V9HW09
LinkDB All DBs
Structure
PDB: 

Position
19q13.2
AA seq 350 aa AA seqDB search
MFIKGRAPRAPPRERRRATRGGLRQVVAPPRALGSTSRPHFRRASVCRRRCRKSGGLLAA
SRKMAAAAVNGAAGFSSSGPAATSGAVLQAATGMYEQLKGEWNRKSPNLSKCGEELGRLK
LVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKE
QLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGS
YNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMT
DYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgttcattaagggcagggctccgagggcgccacctcgagagcgacggcgggctacccgg
ggcgggctgaggcaggttgtagccccgccccgggccttgggctccacctctcggccccac
ttccgccgggcaagcgtttgtaggcggcgctgccgtaaatcaggcggtctgcttgccgca
tcacgcaagatggcggccgcggcggtgaacggggcggcaggcttctcgagctccgggccc
gcggcaacctcgggcgctgttctgcaggccgcgaccggcatgtacgagcaactcaagggc
gagtggaaccgtaaaagccccaatcttagcaagtgcggggaagagctgggtcgactcaag
ctagttcttctggagctcaacttcttgccaaccacagggaccaagctgaccaaacagcag
ctaattctggcccgtgacatactggagatcggggcccaatggagcatcctacgcaaggac
atcccctccttcgagcgctacatggcccagctcaaatgctactactttgattacaaggag
cagctccccgagtcagcctatatgcaccagctcttgggcctcaacctcctcttcctgctg
tcccagaaccgggtggctgagttccacacggagttggagcggctgcctgccaaggacata
cagaccaatgtctacatcaagcacccagtgtccctggagcaatacctgatggagggcagc
tacaacaaagtgttcctggccaagggtaacatccccgccgagagctacaccttcttcatt
gacatcctgctcgacactatcagggatgagatcgctgggtgcatcgagaaggcctacgag
aaaatccttttcactgaggccacccggatcctcttcttcaacacacccaaaaagatgaca
gactacgccaagaagcgagggtgggtcctgggccccaacaactactacagttttgccagc
cagcagcagaagccggaagacaccaccattccctccacagaactggccaaacaggtcatc
gagtatgcccggcagctggagatgatcgtctga

KEGG   Homo sapiens (human): 5717Help
Entry
5717              CDS       T01001                                 

Gene name
PSMD11, Rpn6, S9, p44.5
Definition
(RefSeq) proteasome 26S subunit, non-ATPase 11
  KO
K03036  26S proteasome regulatory subunit N6
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5717 (PSMD11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5717 (PSMD11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5717 (PSMD11)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     5717 (PSMD11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPN6_N PCI RPN6_C_helix TPR_12 DDRGK DUF2153 SbsC_C AAA_16
Motif
Other DBs
NCBI-GeneID: 5717
NCBI-ProteinID: NP_001257411
OMIM: 604449
HGNC: 9556
Ensembl: ENSG00000108671
Vega: OTTHUMG00000132811
Pharos: O00231(Tbio)
UniProt: O00231
LinkDB All DBs
Structure
PDB: 

Position
17q11.2
AA seq 422 aa AA seqDB search
MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKT
GQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSE
KRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHAL
SNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYD
SIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLA
DFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKAD
VERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKK
LT
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggtggtggagttccagagagcccagtctctactcagcaccgaccgg
gaggcctccatcgacatcctccactccatcgtgaagcgtgacattcaggaaaacgatgaa
gaggcagtgcaagtcaaagagcagagcatcctggaactgggatctctcctggcaaagact
ggacaagctgcagagcttggaggactcctgaagtatgtacgacccttcttgaattccatc
agcaaggctaaagcagctcgcctggtccgatctcttcttgatctgtttcttgatatggaa
gcagctacagggcaggaggtcgagctgtgtttagagtgcatcgaatgggccaagtcagag
aaaagaactttcttacgccaagctttggaggcaagactggtgtctttgtactttgatacc
aagaggtaccaggaagcattgcatttgggttctcagctgctgcgggagttgaaaaagatg
gacgacaaagctcttttggtggaagtacagcttttagaaagcaaaacataccatgccctg
agcaacctgccgaaagcccgagctgccttaacttctgctcgaaccacagcaaatgccatc
tactgcccccctaaattgcaggccaccttggacatgcagtcgggtattatccatgcagca
gaagagaaggactggaaaactgcgtactcatacttctatgaggcatttgagggttatgac
tccatcgacagccccaaggccatcacatctctgaagtacatgttgctgtgcaaaatcatg
ctcaacaccccagaagatgtccaggctttggtgagcgggaagcttgcacttcggtatgca
gggaggcagacagaagcattaaaatgcgtggctcaggctagcaagaacagatcactggca
gattttgaaaaggctctgacagattaccgggcagagctccgggatgacccaatcatcagc
acacacttggccaagttgtatgataacttactagaacagaatctgatccgagtcattgag
cctttttccagagtacagattgaacacatatctagtctcatcaaactctccaaggccgac
gtggaaaggaaattatcacagatgattcttgacaagaaatttcatgggattttggaccag
ggggagggtgtcctgattattttcgatgaacccccagtagataaaacttacgaagctgct
ctggaaacaattcagaacatgagcaaagtagtggattccctctacaacaaagccaagaaa
ctgacatag

KEGG   Homo sapiens (human): 5718Help
Entry
5718              CDS       T01001                                 

Gene name
PSMD12, Rpn5, STISS, p55
Definition
(RefSeq) proteasome 26S subunit, non-ATPase 12
  KO
K03035  26S proteasome regulatory subunit N5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5718 (PSMD12)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5718 (PSMD12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5718 (PSMD12)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     5718 (PSMD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI RPN5_C
Motif
Other DBs
NCBI-GeneID: 5718
NCBI-ProteinID: NP_002807
OMIM: 604450
HGNC: 9557
Ensembl: ENSG00000197170
Vega: OTTHUMG00000140376
Pharos: O00232(Tbio)
UniProt: O00232 A0A0S2Z489
LinkDB All DBs
Structure
PDB: 

Position
17q24.2
AA seq 456 aa AA seqDB search
MADGGSERADGRIVKMEVDYSATVDQRLPECAKLAKEGRLQEVIETLLSLEKQTRTASDM
VSTSRILVAVVKMCYEAKEWDLLNENIMLLSKRRSQLKQAVAKMVQQCCTYVEEITDLPI
KLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQNGDVKEAASILQELQVETYGSMEKK
ERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQEENTEKLKLKYYNLMIQLDQHEGSY
LSICKHYRAIYDTPCIQAESEKWQQALKSVVLYVILAPFDNEQSDLVHRISGDKKLEEIP
KYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKRWKDLKNRVVE
HNIRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNLVVNKTIFAKVDRLAGIINFQRPKD
PNNLLNDWSQKLNSLMSLVNKTTHLIAKEEMIHNLQ
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcggacggcggctcggagcgggctgacgggcgcatcgtcaagatggaggtggactac
agcgccacggtggatcagcgcctacccgagtgtgcgaagctagccaaggaaggaagactt
caagaagtcattgaaacccttctctctctggaaaagcagactcgtactgcttccgatatg
gtatcgacatcccgtatcttagttgcagtagtgaagatgtgctatgaggctaaagaatgg
gatttacttaatgaaaatattatgcttttgtccaaaaggcggagtcagttaaaacaagct
gttgccaaaatggttcaacagtgctgtacttatgttgaggaaatcacagaccttcctatc
aaacttcgattaattgatactctacgaatggttaccgaaggcaagatttatgttgaaatt
gagcgtgcgcgactgactaaaacattagcaactataaaagaacaaaatggtgatgtgaaa
gaggcagcctccattttacaggagttacaggtggaaacctacgggtcaatggaaaagaaa
gagcgagtggaatttattttggagcaaatgaggctctgcctagctgtgaaggattacatt
cgaacacaaatcatcagcaagaaaattaacaccaaatttttccaggaagaaaatacagag
aaattaaagttgaagtactataatttaatgattcagctggatcaacatgagggatcctat
ttgtctatttgtaagcactacagagcaatatatgatactccctgtatacaggcagaaagt
gaaaaatggcagcaggctctgaagagtgttgtactctatgttatcctggctccttttgac
aatgaacagtcagatttggttcaccgaataagtggtgacaagaagttagaagaaattccc
aaatacaaggatcttttaaagctttttaccacaatggagttgatgcgttggtccacactt
gttgaggactatggaatggaattaagaaaaggttcccttgagagtcctgcaacggatgtt
tttggttctacagaggaaggtgaaaaaaggtggaaagacttgaagaacagagttgttgaa
cataatattagaataatggccaagtattatactcggataacaatgaaaaggatggcacag
cttctggatctatctgttgatgagtccgaagcctttctctcaaatctagtagttaacaag
accatctttgctaaagtagacagattagcaggaattatcaacttccagagacccaaggat
ccaaataatttattaaatgactggtctcagaaactgaactcattaatgtctctggttaac
aaaactacgcatctcatagccaaagaggagatgatacataatctacaataa

KEGG   Homo sapiens (human): 5719Help
Entry
5719              CDS       T01001                                 

Gene name
PSMD13, HSPC027, Rpn9, S11, p40.5
Definition
(RefSeq) proteasome 26S subunit, non-ATPase 13
  KO
K03039  26S proteasome regulatory subunit N9
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5719 (PSMD13)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5719 (PSMD13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5719 (PSMD13)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     5719 (PSMD13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 5719
NCBI-ProteinID: NP_002808
OMIM: 603481
HGNC: 9558
Ensembl: ENSG00000185627
Vega: OTTHUMG00000119072
Pharos: Q9UNM6(Tbio)
UniProt: Q9UNM6
LinkDB All DBs
Structure
PDB: 

Position
11p15.5
AA seq 376 aa AA seqDB search
MKDVPGFLQQSQNSGPGQPAVWHRLEELYTKKLWHQLTLQVLDFVQDPCFAQGDGLIKLY
ENFISEFEHRVNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGA
LKLNIGDLQVTKETIEDVEEMLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFL
GCVDIKDLPVSEQQERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTLYAF
NSGNVERFQTLKTAWGQQPDLAANEAQLLRKIQLLCLMEMTFTRPANHRQLTFEEIAKSA
KITVNEVELLVMKALSVGLVKGSIDEVDKRVHMTWVQPRVLDLQQIKGMKDRLEFWCTDV
KSMEMLVEHQAHDILT
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacgtaccgggcttcctacagcagagccagaactccgggcccgggcagcccgct
gtgtggcaccgtctggaggagctctacacgaagaagttgtggcatcagctgacacttcag
gtgcttgattttgtgcaggatccgtgctttgcccaaggagatggtctcattaagctttat
gaaaactttatcagtgaatttgaacacagggtgaaccctttgtccctcgtggaaatcatt
cttcatgtagttagacagatgactgatcctaatgtggctcttacttttctggaaaagact
cgtgagaaggtgaaaagtagtgatgaggcagtgatcctgtgtaaaacagcaattggagct
ctaaaattaaacatcggggacctacaggttacaaaggaaacaattgaagatgttgaagaa
atgctcaacaaccttcctggtgtgacatcggttcacagtcgtttctatgatctctccagt
aaatactatcaaacaatcggaaaccacgcgtcctactacaaagatgctctgcggtttttg
ggctgtgttgacatcaaggatctaccagtgtctgagcagcaggagagagccttcacgctg
gggctagcaggacttctcggcgagggagtttttaactttggagaactcctcatgcaccct
gtgctggagtccctgaggaatactgaccggcagtggctgattgacaccctctatgccttc
aacagtggcaacgtagagcggttccagactctgaagactgcctggggccagcagcctgat
ttagcagctaatgaagcccagcttctgaggaaaattcagttgttgtgcctcatggagatg
actttcacacgacctgccaatcacagacaactcacttttgaagaaattgccaaaagtgct
aaaatcacagtgaatgaggtggagcttctggtgatgaaggccctttcggtggggctggtg
aaaggcagtatagacgaggtggacaaacgagtccacatgacctgggtgcagccccgagtg
ttggatttgcaacagatcaagggaatgaaggaccgcctggagttctggtgcacggatgtg
aagagcatggagatgctggtggagcaccaggcccatgacatcctcacctag

KEGG   Homo sapiens (human): 7979Help
Entry
7979              CDS       T01001                                 

Gene name
SEM1, C7orf76, DSS1, ECD, SHFD1, SHFM1, SHSF1, Shfdg1
Definition
(RefSeq) SEM1 26S proteasome complex subunit
  KO
K10881  26 proteasome complex subunit DSS1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa03440  Homologous recombination
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    7979 (SEM1)
  09124 Replication and repair
   03440 Homologous recombination
    7979 (SEM1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    7979 (SEM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7979 (SEM1)
   03051 Proteasome [BR:hsa03051]
    7979 (SEM1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7979 (SEM1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    7979 (SEM1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     7979 (SEM1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     7979 (SEM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSS1_SEM1
Motif
Other DBs
NCBI-GeneID: 7979
NCBI-ProteinID: NP_006295
OMIM: 601285
HGNC: 10845
Ensembl: ENSG00000127922
Vega: OTTHUMG00000150680
Pharos: P60896(Tbio)
UniProt: P60896 Q6IBB7
LinkDB All DBs
Structure
PDB: 

Position
7q21.3
AA seq 70 aa AA seqDB search
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAEL
EKHGYKMETS
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagaaaaagcagccggtagacttaggtctgttagaggaagacgacgagtttgaa
gagttccctgccgaagactgggctggcttagatgaagatgaagatgcacatgtctgggag
gataattgggatgatgacaatgtagaggatgacttctctaatcagttacgagctgaacta
gagaaacatggttataagatggagacttcatag

KEGG   Homo sapiens (human): 9861Help
Entry
9861              CDS       T01001                                 

Gene name
PSMD6, Rpn7, S10, SGA-113M, p42A, p44S10
Definition
(RefSeq) proteasome 26S subunit, non-ATPase 6
  KO
K03037  26S proteasome regulatory subunit N7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    9861 (PSMD6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    9861 (PSMD6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    9861 (PSMD6)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     9861 (PSMD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPN7 PCI
Motif
Other DBs
NCBI-GeneID: 9861
NCBI-ProteinID: NP_055629
OMIM: 617857
HGNC: 9564
Ensembl: ENSG00000163636
Vega: OTTHUMG00000158765
Pharos: Q15008(Tbio)
UniProt: Q15008
LinkDB All DBs
Structure
PDB: 

Position
3p14.1
AA seq 389 aa AA seqDB search
MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKS
LDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGA
LTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRL
KVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKV
IKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMR
IHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPD
SKNWQYQETIKKGDLLLNRVQKLSRVINM
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggagaacctggaggaggagggtctgcccaagaaccccgacttgcgtatcgcg
cagctgcgcttcctgctcagcctgcccgagcaccgcggagacgctgccgtgcgcgacgag
ctgatggcggccgtccgcgataacaacatggctccttactatgaagccttgtgcaaatcc
ctcgactggcagatagacgtggacctactcaataaaatgaagaaggcaaatgaagatgag
ttgaagcgtttggatgaggagctggaagatgcagagaagaatctaggagagagcgaaatt
cgcgatgcaatgatggcaaaggccgagtacctctgccggataggtgacaaagagggagct
ctgacagcctttcgcaagacatatgacaaaactgtggccctgggtcaccgattggatatt
gtattctatctccttaggattggcttattttatatggataatgatctcatcacacgaaac
acagaaaaggccaaaagcttaatagaagaaggaggagactgggacaggagaaaccgccta
aaagtgtatcagggtctttattgtgtggctattcgtgatttcaaacaggcagctgaactc
ttccttgacactgtttcaacatttacatcctatgaactcatggattataaaacatttgtg
acttatactgtctatgtcagtatgattgccttagaaagaccagatctcagggaaaaggtc
attaaaggagcagagattcttgaagtgttgcacagtcttccagcagttcggcagtatctg
ttttcactctatgaatgccgttactctgttttcttccaatcattagcggttgtggaacag
gaaatgaaaaaggactggctttttgcccctcattatcgatactatgtaagagaaatgaga
attcatgcatacagtcagctgctggaatcatataggtcattaacccttggctatatggca
gaagcgtttggtgttggtgtggaattcattgatcaggaactgtccaggtttattgctgcc
gggagactacactgcaaaatagataaagtgaatgaaatagtagaaaccaacagacctgat
agcaagaactggcagtaccaagaaactatcaagaaaggagatctgctactaaacagagtt
caaaaactttccagagtaattaatatgtaa

DBGET integrated database retrieval system