KEGG   Homo sapiens (human): 10235Help
Entry
10235             CDS       T01001                                 

Gene name
RASGRP2, CALDAG-GEFI, CDC25L
Definition
(RefSeq) RAS guanyl releasing protein 2
  KO
K12361  RAS guanyl-releasing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04062  Chemokine signaling pathway
hsa04611  Platelet activation
hsa05200  Pathways in cancer
Disease
H01235  Bleeding disorder platelet-type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    10235 (RASGRP2)
   04015 Rap1 signaling pathway
    10235 (RASGRP2)
   04010 MAPK signaling pathway
    10235 (RASGRP2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    10235 (RASGRP2)
   04062 Chemokine signaling pathway
    10235 (RASGRP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    10235 (RASGRP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF EF-hand_1 C1_1 EF-hand_6 EF-hand_7 EF-hand_5 RasGEF_N EF-hand_8
Motif
Other DBs
NCBI-GeneID: 10235
NCBI-ProteinID: NP_001092140
OMIM: 605577
HGNC: 9879
Ensembl: ENSG00000068831
Vega: OTTHUMG00000045420
Pharos: Q7LDG7(Tbio)
UniProt: Q7LDG7
LinkDB All DBs
Structure
PDB: 

Position
11q13.1
AA seq 609 aa AA seqDB search
MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIY
QQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLID
IDSVPTYKWKRQVTQRNPVGQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRALVITHFVHVAEKLLQLQNF
NTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAACVGFR
FPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDL
LSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQ
ALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEM
VSYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQC
KDRLSVECRRRAQSVSLEGSAPSPSPMHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTV
EDGVFDIHL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaccctggacctggacaagggctgcacggtggaggagctgctccgcgggtgc
atcgaagccttcgatgactccgggaaggtgcgggacccgcagctggtgcgcatgttcctc
atgatgcacccctggtacatcccctcctctcagctggcggccaagctgctccacatctac
caacaatcccggaaggacaactccaattccctgcaggtgaaaacgtgccacctggtcagg
tactggatctccgccttcccagcggagtttgacttgaacccggagttggctgagcagatc
aaggagctgaaggctctgctagaccaagaagggaaccgacggcacagcagcctaatcgac
atagacagcgtccctacctacaagtggaagcggcaggtgactcagcggaaccctgtggga
cagaaaaagcgcaagatgtccctgttgtttgaccacctggagcccatggagctggcggag
catctcacctacttggagtatcgctccttctgcaagatcctgtttcaggactatcacagt
ttcgtgactcatggctgcactgtggacaaccccgtcctggagcggttcatctccctcttc
aacagcgtctcacagtgggtgcagctcatgatcctcagcaaacccacagccccgcagcgg
gccctggtcatcacacactttgtccacgtggcggagaagctgctacagctgcagaacttc
aacacgctgatggcagtggtcgggggcctgagccacagctccatctcccgcctcaaggag
acccacagccacgttagccctgagaccatcaagctctgggagggtctcacggaactagtg
acggcgacaggcaactatggcaactaccggcgtcggctggcagcctgtgtgggcttccgc
ttcccgatcctgggtgtgcacctcaaggacctggtggccctgcagctggcactgcctgac
tggctggacccagcccggacccggctcaacggggccaagatgaagcagctctttagcatc
ctggaggagctggccatggtgaccagcctgcggccaccagtacaggccaaccccgacctg
ctgagcctgctcacggtgtctctggatcagtatcagacggaggatgagctgtaccagctg
tccctgcagcgggagccgcgctccaagtcctcgccaaccagccccacgagttgcacccca
ccaccccggcccccggtactggaggagtggacctcggctgccaaacccaagctggatcag
gccctcgtggtggagcacatcgagaagatggtggagtctgtgttccggaactttgacgtc
gatggggatggccacatctcacaggaagaattccagatcatccgtgggaacttcccttac
ctcagcgcctttggggacctcgaccagaaccaggatggctgcatcagcagggaggagatg
gtttcctatttcctgcgctccagctctgtgttgggggggcgcatgggcttcgtacacaac
ttccaggagagcaactccttgcgccccgtcgcctgccgccactgcaaagccctgatcctg
ggcatctacaagcagggcctcaaatgccgagcctgtggagtgaactgccacaagcagtgc
aaggatcgcctgtcagttgagtgtcggcgcagggcccagagtgtgagcctggaggggtct
gcaccctcaccctcacccatgcacagccaccatcaccgcgccttcagcttctctctgccc
cgccctggcaggcgaggctccaggcctccagagatccgtgaggaggaggtacagacggtg
gaggatggggtgtttgacatccacttgtaa

DBGET integrated database retrieval system