KEGG   Homo sapiens (human): 10241
Entry
10241             CDS       T01001                                 

Gene name
CALCOCO2, NDP52
Definition
(RefSeq) calcium binding and coiled-coil domain 2
  KO
K21348  calcium-binding and coiled-coil domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
hsa05131  Shigellosis
hsa05164  Influenza A
Network
nt06133  RLR signaling (viruses)
nt06170  Influenza A virus (IAV)
nt06421  Mitophagy
nt06464  Amyotrophic lateral sclerosis
  Element
N00734  IAV PB1-F2/PB2 to RIG-I-like receptor signaling pathway
N01137  PINK-Parkin-mediated autophagosome formation
N01140  TBK1-mediated autophagosome formation
N01141  Mutation-inactivated TBK1 to TBK1-mediated autophagosome formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    10241 (CALCOCO2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    10241 (CALCOCO2)
  09172 Infectious disease: viral
   05164 Influenza A
    10241 (CALCOCO2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10241 (CALCOCO2)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    10241 (CALCOCO2)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Xenophagy
   Cargo receptors
    10241 (CALCOCO2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    10241 (CALCOCO2)
SSDB
Motif
Pfam: SKICH Zn-C2H2_12 NAD_binding_10 HALZ Crescentin
Other DBs
NCBI-GeneID: 10241
NCBI-ProteinID: NP_005822
OMIM: 604587
HGNC: 29912
Ensembl: ENSG00000136436
Vega: OTTHUMG00000160505
Pharos: Q13137(Tbio)
UniProt: Q13137
LinkDB
Structure
PDB: 

Position
17q21.32
AA seq 446 aa
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFR
VGWKTTREYYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGAS
IPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKK
QEELETLQSINKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQ
EKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQ
QELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLLSYMGLDFNSLPYQV
PTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCF
NCPICDKIFPATEKQIFEDHVFCHSL
NT seq 1341 nt   +upstreamnt  +downstreamnt
atggaggagaccatcaaagatccccccacatcagctgtcttgctggatcactgtcatttc
tctcaggtcatctttaacagtgtggagaagttctacatccctggaggggacgtcacatgt
cattataccttcacccagcatttcatccctcgtcgaaaggattggattggcatctttaga
gtggggtggaagacaacccgtgagtattacaccttcatgtgggttactttgcccattgac
ctaaacaacaaatcagctaaacagcaggaagtccaattcaaagcttactacctgcccaag
gatgatgagtattaccagttctgctatgtggatgaggatggtgtggtccggggagcaagt
attcctttccaattccgtccagaaaatgaggaagacatcctggttgttaccactcaggga
gaggtggaagagattgagcagcacaacaaggagctttgcaaagaaaaccaggagctgaag
gacagctgtatcagcctccagaagcagaactcagacatgcaggctgagctccaaaagaag
caggaggagctagaaaccctacagagcatcaataagaagttggaactgaaagtgaaagaa
cagaaggactattgggagacagagctgcttcaactgaaagaacaaaaccagaagatgtcc
tcagaaaatgagaagatgggaatcagagtggatcagcttcaggcccagctgtcaactcaa
gagaaagaaatggagaagcttgttcagggagatcaagataagacagagcagttagagcag
ctgaaaaaggaaaatgaccacctctttctcagtttaactgaacagaggaaggaccagaag
aagctcgagcagacagtggagcaaatgaagcagaatgaaactactgcaatgaagaaacaa
caggaattaatggatgaaaactttgacctgtcaaaaagactgagtgagaacgaaattata
tgtaatgctctgcagagacagaaagagagattggaaggagaaaatgatcttttgaagagg
gagaacagcagattgctcagttacatgggtctggattttaattctttgccgtatcaagta
cctacttcagatgaaggaggcgcaagacaaaatccaggacttgcctatggaaacccatat
tctggtatccaagaaagttcttcccccagcccgctctccatcaagaaatgccctatctgc
aaagcagatgatatttgtgatcacaccttggagcaacagcagatgcagcccctttgtttc
aattgtccaatttgtgacaagatcttcccagctacagagaagcagatctttgaagaccac
gtgttctgccactctctctga

DBGET integrated database retrieval system