KEGG   Homo sapiens (human): 10242
Entry
10242             CDS       T01001                                 

Gene name
KCNMB2
Definition
(RefSeq) potassium calcium-activated channel subfamily M regulatory beta subunit 2
  KO
K04938  potassium large conductance calcium-activated channel subfamily M beta member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    10242 (KCNMB2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    10242 (KCNMB2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    10242 (KCNMB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    10242 (KCNMB2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   10242 (KCNMB2)
SSDB
Motif
Pfam: CaKB KcnmB2_inactiv AAA_8 tRNA-synt_1g
Other DBs
NCBI-GeneID: 10242
NCBI-ProteinID: NP_001265840
OMIM: 605214
HGNC: 6286
Ensembl: ENSG00000197584
Vega: OTTHUMG00000157264
Pharos: Q9Y691(Tbio)
UniProt: Q9Y691 B5BNW5
LinkDB
Position
3q26.32
AA seq 235 aa
MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIM
MYFLLGITLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNL
TSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEG
NQKSVILTKLYSSNVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR
NT seq 708 nt   +upstreamnt  +downstreamnt
atgtttatatggaccagtggccggacctcttcatcttatagacatgatgaaaaaagaaat
atttaccagaaaatcagggaccatgacctcctggacaaaaggaaaacagtcacagcactg
aaggcaggagaggaccgagctattctcctgggactggctatgatggtgtgctccatcatg
atgtattttctgctgggaatcacactcctgcgctcatacatgcagagcgtgtggaccgaa
gagtctcaatgcaccttgctgaatgcgtccatcacggaaacatttaattgctccttcagc
tgtggtccagactgctggaaactttctcagtacccctgcctccaggtgtacgttaacctg
acttcttccggggaaaagctcctcctctaccacacagaagagacaataaaaatcaatcag
aagtgctcctatatacctaaatgtggaaaaaattttgaagaatccatgtccctggtgaat
gttgtcatggaaaacttcaggaagtatcaacacttctcctgctattctgacccagaagga
aaccagaagagtgttatcctaacaaaactctacagttccaacgtgctgttccattcactc
ttctggccaacctgtatgatggctgggggtgtggcaattgttgccatggtgaaacttaca
cagtacctctccctactatgtgagaggatccaacggatcaatagataa

KEGG   Homo sapiens (human): 157855
Entry
157855            CDS       T01001                                 

Gene name
KCNU1, KCNMC1, KCa5, KCa5.1, Kcnma3, Slo3
Definition
(RefSeq) potassium calcium-activated channel subfamily U member 1
  KO
K05274  potassium large conductance calcium-activated channel subfamily M alpha member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    157855 (KCNU1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    157855 (KCNU1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    157855 (KCNU1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    157855 (KCNU1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   157855 (KCNU1)
SSDB
Motif
Pfam: BK_channel_a Ion_trans Ion_trans_2
Other DBs
NCBI-GeneID: 157855
NCBI-ProteinID: NP_001027006
OMIM: 615215
HGNC: 18867
Ensembl: ENSG00000215262
Vega: OTTHUMG00000163981
Pharos: A8MYU2(Tbio)
UniProt: A8MYU2
LinkDB
Structure
PDB: 
4HPF

Position
8p11.23
AA seq 1149 aa
MFQTKLRNETWEDLPKMSCTTEIQAAFILSSFVTFFSGLIILLIFRLIWRSVKKWQIIKG
TGIILELFTSGTIARSHVRSLHFQGQFRDHIEMLLSAQTFVGQVLVILVFVLSIGSLIIY
FINSADPVGSCSSYEDKTIPIDLVFNAFFSFYFGLRFMAADDKIKFWLEMNSIVDIFTIP
PTFISYYLKSNWLGLRFLRALRLLELPQILQILRAIKTSNSVKFSKLLSIILSTWFTAAG
FIHLVENSGDPWLKGRNSQNISYFESIYLVMATTSTVGFGDVVAKTSLGRTFIMFFTLGS
LILFANYIPEMVELFANKRKYTSSYEALKGKKFIVVCGNITVDSVTAFLRNFLRDKSGEI
NTEIVFLGETPPSLELETIFKCYLAYTTFISGSAMKWEDLRRVAVESAEACLIIANPLCS
DSHAEDISNIMRVLSIKNYDSTTRIIIQILQSHNKVYLPKIPSWNWDTGDNIICFAELKL
GFIAQGCLVPGLCTFLTSLFVEQNKKVMPKQTWKKHFLNSMKNKILTQRLSDDFAGMSFP
EVARLCFLKMHLLLIAIEYKSLFTDGFCGLILNPPPQVRIRKNTLGFFIAETPKDVRRAL
FYCSVCHDDVFIPELITNCGCKSRSRQHITVPSVKRMKKCLKGISSRISGQDSPPRVSAS
TSSISNFTTRTLQHDVEQDSDQLDSSGMFHWCKPTSLDKVTLKRTGKSKYKFRNHIVACV
FGDAHSAPMGLRNFVMPLRASNYTRKELKDIVFIGSLDYLQREWRFLWNFPQIYILPGCA
LYSGDLHAANIEQCSMCAVLSPPPQPSSNQTLVDTEAIMATLTIGSLQIDSSSDPSPSVS
EETPGYTNGHNEKSNCRKVPILTELKNPSNIHFIEQLGGLEGSLQETNLHLSTAFSTGTV
FSGSFLDSLLATAFYNYHVLELLQMLVTGGVSSQLEQHLDKDKVYGVADSCTSLLSGRNR
CKLGLLSLHETILSDVNPRNTFGQLFCGSLDLFGILCVGLYRIIDEEELNPENKRFVITR
PANEFKLLPSDLVFCAIPFSTACYKRNEEFSLQKSYEIVNKASQTTETHSDTNCPPTIDS
VTETLYSPVYSYQPRTNSLSFPKQIAWNQSRTNSIISSQIPLGDNAKENERKTSDEVYDE
DPFAYSEPL
NT seq 3450 nt   +upstreamnt  +downstreamnt
atgtttcagactaagctacgaaatgaaacttgggaagacttgccaaaaatgtcctgcaca
actgagatccaagcagcattcattctctcttcctttgtgaccttcttcagtggactcatc
atcctgttgatcttcaggctgatctggagatctgttaaaaaatggcaaatcatcaaggga
acaggaattatcttggaactgttcacatcaggtaccatcgctaggagccatgtaagaagc
ctccacttccagggacaatttcgtgatcatatagaaatgttgctttcagcccagaccttt
gtggggcaagtgttggtgatccttgtctttgtactaagcattgggtctcttataatctat
ttcatcaattctgctgaccctgttggaagctgttcatcatatgaagacaaaaccattcct
attgatttggttttcaatgctttctttagtttctattttggattgaggtttatggcagct
gatgacaagatcaagttctggctggagatgaattcaatcgtagacatctttaccatccca
ccaacctttatttcttattatttgaagagcaattggctaggtttaaggttcctaagagcc
ttgcgcctgctagaactccctcaaatcttgcaaattctacgagccatcaagaccagtaac
tcagtgaagttttccaaactgctgtcaataattctcagtacctggttcacagctgcggga
ttcattcacctggtggaaaattctggtgatccctggctcaaaggtagaaattcacagaat
atatcatattttgagtcaatttacctggtcatggcaacaacgtcaaccgttggatttgga
gatgtggtagccaagacatccttaggacggaccttcatcatgttcttcacactggggagt
ttgatattatttgcgaactatatacctgaaatggtggaactgtttgctaacaagaggaaa
tacaccagttcctatgaagcactcaaaggaaagaagtttattgtggtctgtggaaacatc
actgtggacagtgtgaccgctttcctgaggaatttcctccgcgacaagtcaggagagatc
aacactgaaattgttttcctgggagaaacccctccttctttggaacttgaaaccatattt
aaatgctacttggcctacacaacgttcatttctggatctgcaatgaagtgggaggatctg
aggcgagttgcggtggaatctgcagaggcatgcctgattatagccaatcctttgtgcagt
gattcccatgctgaagatatttccaacattatgagggtgctctctatcaagaactatgat
tctaccaccagaatcatcatacagatactgcaatcccataacaaggtttatctgccaaag
attcccagctggaactgggacaccggagacaacatcatctgctttgctgaattaaaactt
ggatttatcgcccaaggctgtttggtgccaggcttgtgtaccttcctaacatctctattt
gtggagcaaaacaaaaaggttatgcctaaacagacctggaagaaacacttcttgaatagc
atgaaaaacaaaattctgacccaacgtctctctgatgactttgctggaatgagctttcct
gaagttgcccggctctgctttctgaagatgcacctcctgttgatagccatcgaatacaag
tccctctttacggatggtttctgtggtctgatactaaatccacctccacaagtgaggata
cgtaagaacacattagggttctttattgctgaaactccaaaggacgtcagaagagccttg
ttttactgttcagtctgtcatgatgatgtgttcattcctgagctaattacaaactgtggc
tgcaaaagcagaagccggcagcacatcacagtgccatcggtaaagagaatgaaaaaatgt
ctgaagggaatctcctctcgtatatcagggcaggattctccgccaagggtatctgcaagc
acttcgagcatatcaaacttcaccaccaggactcttcaacatgatgtagaacaagattct
gaccagcttgatagcagtgggatgtttcactggtgcaaaccaacctctttggacaaggtg
actctgaaacgaactggcaagtcaaagtataagtttcggaaccatattgtagcatgtgta
tttggagatgcccactcagccccgatggggcttcggaactttgtaatgcccttgagagcc
agcaactataccaggaaggagctgaaggacatagtgttcattgggtctctggactatcta
cagagagaatggcgatttctctggaattttccccagatatacattctgcctggatgtgca
ctttattctggagacctccatgcggccaacatagagcaatgctccatgtgtgctgtcttg
tcccccccaccccagccatcaagcaaccagactttggtagacacagaagccatcatggca
accctcaccatcggatccttgcaaattgactcctcctctgacccgtcaccctcagtgtca
gaggagactccaggttacacaaatggacataatgagaaatcaaactgccgaaaagtccct
atccttactgaactgaaaaatccttccaacattcactttattgaacagcttggtggactg
gaagggtccctccaagaaacaaatctgcatctcagcactgccttttctacgggcactgtt
ttttccggcagcttcttggattctctgctggccacggccttctacaattatcatgtcctg
gaattgcttcagatgctggtgacaggaggagtaagttctcagctggaacaacatttagat
aaggataaagtctatggtgtggcagatagctgcacgtcgctcttgtctggaagaaaccgg
tgtaagctggggcttctgtccttacacgaaaccattttatcagacgttaatccaagaaac
acctttggacaactgttctgtggctcattagatctttttggaatcctgtgtgttggctta
taccgaataattgatgaagaggagctcaacccagaaaacaaaaggtttgtgatcacccgg
ccagccaatgagttcaagctgctgccttcagatcttgtgttttgtgccatacccttcagc
actgcttgttataaaaggaatgaagagttctcattgcaaaagtcatatgaaattgtaaat
aaagcatcacagacaacagagacacattcagacacaaattgtcctcccaccattgattca
gttactgagacattgtattcaccagtctattcttaccagccgagaactaactccctctct
tttcctaagcaaatagcatggaatcagagtagaacaaacagtattatatcatctcagata
cctttaggtgacaatgcaaaagaaaatgaaaggaaaacttcagatgaggtttatgatgag
gatccctttgcatattcagagccactatag

KEGG   Homo sapiens (human): 27094
Entry
27094             CDS       T01001                                 

Gene name
KCNMB3, BKBETA3, HBETA3, K(VCA)BETA-3, KCNMB2, KCNMBL, SLO-BETA-3, SLOBETA3
Definition
(RefSeq) potassium calcium-activated channel subfamily M regulatory beta subunit 3
  KO
K04939  potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    27094 (KCNMB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    27094 (KCNMB3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    27094 (KCNMB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    27094 (KCNMB3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   27094 (KCNMB3)
SSDB
Motif
Pfam: CaKB tRNA-synt_1g
Other DBs
NCBI-GeneID: 27094
NCBI-ProteinID: NP_055222
OMIM: 605222
HGNC: 6287
Ensembl: ENSG00000171121
Vega: OTTHUMG00000157337
Pharos: Q9NPA1(Tbio)
UniProt: Q9NPA1
LinkDB
Position
3q26.32
AA seq 279 aa
MDFSPSSELGFHFVAFILLTRHRTAFPASGKKRETDYSDGDPLDVHKRLPSSAGEDRAVM
LGFAMMGFSVLMFFLLGTTILKPFMLSIQREESTCTAIHTDIMDDWLDCAFTCGVHCHGQ
GKYPCLQVFVNLSHPGQKALLHYNEEAVQINPKCFYTPKCHQDRNDLLNSALDIKEFFDH
KNGTPFSCFYSPASQSEDVILIKKYDQMAIFHCLFWPSLTLLGGALIVGMVRLTQHLSLL
CEKYSTVVRDEVGGKVPYIEQHQFKLCIMRRSKGRAEKS
NT seq 840 nt   +upstreamnt  +downstreamnt
atggacttttcaccaagctctgaactgggatttcattttgttgcattcatcctgctcacg
agacacaggacagcctttcctgcctcagggaagaagagagagacagactacagtgatgga
gacccactagatgtgcacaagaggctgccatccagtgctggagaggaccgagccgtgatg
ctggggtttgccatgatgggcttctcagtcctaatgttcttcttgctcggaacaaccatt
ctaaagccttttatgctcagcattcagagagaagaatcgacctgcactgccatccacaca
gatatcatggacgactggctggactgtgccttcacctgtggtgtgcactgccacggtcag
gggaagtacccgtgtcttcaggtgtttgtgaacctcagccatccaggtcagaaagctctc
ctacattataatgaagaggctgtccagataaatcccaagtgcttttacacacctaagtgc
caccaagatagaaatgatttgctcaacagtgctctggacataaaagaattcttcgatcac
aaaaatggaacccccttttcatgcttctacagtccagccagccaatctgaagatgtcatt
cttataaaaaagtatgaccaaatggctatcttccactgtttattttggccttcactgact
ctgctaggtggtgccctgattgttggcatggtgagattaacacaacacctgtccttactg
tgtgaaaaatatagcactgtagtcagagatgaggtaggtggaaaagtaccttatatagaa
cagcatcagttcaaactgtgcattatgaggaggagcaaaggaagagcagagaaatcttaa

KEGG   Homo sapiens (human): 27345
Entry
27345             CDS       T01001                                 

Gene name
KCNMB4
Definition
(RefSeq) potassium calcium-activated channel subfamily M regulatory beta subunit 4
  KO
K04941  potassium large conductance calcium-activated channel subfamily M beta member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    27345 (KCNMB4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    27345 (KCNMB4)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    27345 (KCNMB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    27345 (KCNMB4)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   27345 (KCNMB4)
SSDB
Motif
Pfam: CaKB
Other DBs
NCBI-GeneID: 27345
NCBI-ProteinID: NP_055320
OMIM: 605223
HGNC: 6289
Ensembl: ENSG00000135643
Vega: OTTHUMG00000167586
Pharos: Q86W47(Tbio)
UniProt: Q86W47
LinkDB
Structure
PDB: 
5Y7L

Position
12q15
AA seq 210 aa
MAKLRVAYEYTEAEDKSIRLGLFLIISGVVSLFIFGFCWLSPALQDLQATEANCTVLSVQ
QIGEVFECTFTCGADCRGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCK
RENQKNLESVMNWQQYWKDEIGSQPFTCYFNQHQRPDDVLLHRTHDEIVLLHCFLWPLVT
FVVGVLIVVLTICAKSLAVKAEAMKKRKFS
NT seq 633 nt   +upstreamnt  +downstreamnt
atggcgaagctccgggtggcttacgagtacacggaagccgaggacaagagcatccggctc
ggcttgtttctcatcatctccggcgtcgtgtcgctcttcatcttcggcttctgctggctg
agtcccgcgctgcaggatctgcaagccacggaggccaattgcacggtgctgtcggtgcag
cagatcggcgaggtgttcgagtgcaccttcacctgtggcgccgactgcaggggcacctcg
cagtacccctgcgtccaggtctacgtgaacaactctgagtccaactctagggcgctgctg
cacagcgacgagcaccagctcctgaccaaccccaagtgctcctatatccctccctgtaag
agagaaaatcagaagaatttggaaagtgtcatgaattggcaacagtactggaaagatgag
attggttcccagccatttacttgctattttaatcaacatcaaagaccagatgatgtgctt
ctgcatcgcactcatgatgagattgtcctcctgcattgcttcctctggcccctggtgaca
tttgtggtgggcgttctcattgtggtcctgaccatctgtgccaagagcttggcggtcaag
gcggaagccatgaagaagcgcaagttctcttaa

KEGG   Homo sapiens (human): 3778
Entry
3778              CDS       T01001                                 

Gene name
KCNMA1, BKTM, CADEDS, IEG16, KCa1.1, LIWAS, MaxiK, PNKD3, SAKCA, SLO, SLO-ALPHA, SLO1, bA205K10.1, hSlo, mSLO1
Definition
(RefSeq) potassium calcium-activated channel subfamily M alpha 1
  KO
K04936  potassium large conductance calcium-activated channel subfamily M alpha member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04911  Insulin secretion
hsa04924  Renin secretion
hsa04970  Salivary secretion
hsa04972  Pancreatic secretion
Disease
H01258  Generalized epilepsy and paroxysmal dyskinesia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    3778 (KCNMA1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    3778 (KCNMA1)
   04924 Renin secretion
    3778 (KCNMA1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    3778 (KCNMA1)
  09154 Digestive system
   04970 Salivary secretion
    3778 (KCNMA1)
   04972 Pancreatic secretion
    3778 (KCNMA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3778 (KCNMA1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   3778 (KCNMA1)
SSDB
Motif
Pfam: BK_channel_a Ion_trans Ion_trans_2 TrkA_N Lig_chan
Other DBs
NCBI-GeneID: 3778
NCBI-ProteinID: NP_001154824
OMIM: 600150
HGNC: 6284
Ensembl: ENSG00000156113
Vega: OTTHUMG00000018543
Pharos: Q12791(Tclin)
UniProt: Q12791
LinkDB
Structure
PDB: 
3MT5 3NAF

Position
10q22.3
AA seq 1236 aa
MANGGGGGGGSSGGGGGGGGSSLRMSSNIHANHLSLDASSSSSSSSSSSSSSSSSSSSSS
VHEPKMDALIIPVTMEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCH
CGGKTKEAQKINNGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVL
VVLVFALSIGALVIYFIDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKL
WFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKL
VNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYA
KTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLES
VSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVK
IESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSW
NWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNE
MYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEGTLG
FFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRPKMSIYKRMRRACCFDCGRSERD
CSCMSGRVRGNVDTLERAFPLSSVSVNDCSTSFRAFEDEQPSTLSPKKKQRNGGMRNSPN
TSPKLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSG
HVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVS
ILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIG
VLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDD
DPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEEN
ALRGGYSTPQTLANRDRCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRL
RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAGQSRASLSHSSHSSQSSS
KKSSSVHSIPSTANRQNRPKSRESRDKQKYVQEERL
NT seq 3711 nt   +upstreamnt  +downstreamnt
atggcaaatggtggcggcggcggcggcggcagcagcggcggcggcggcggcggcggaggc
agcagtcttagaatgagtagcaatatccacgcgaaccatctcagcctagacgcgtcctcc
tcctcctcctcctcctcttcctcttcttcttcttcctcctcctcttcctcctcgtcctcg
gtccacgagcccaagatggatgcgctcatcatcccggtgaccatggaggtgccgtgcgac
agccggggccaacgcatgtggtgggctttcctggcctcctccatggtgactttcttcggg
ggcctcttcatcatcttgctctggcggacgctcaagtacctgtggaccgtgtgctgccac
tgcgggggcaagacgaaggaggcccagaagattaacaatggctcaagccaggcggatggc
actctcaaaccagtggatgaaaaagaggaggcagtggccgccgaggtcggctggatgacc
tccgtgaaggactgggcgggggtgatgatatccgcccagacactgactggcagagtcctg
gttgtcttagtctttgctctcagcatcggtgcacttgtaatatacttcatagattcatca
aacccaatagaatcctgccagaatttctacaaagatttcacattacagatcgacatggct
ttcaacgtgttcttccttctctacttcggcttgcggtttattgcagccaacgataaattg
tggttctggctggaagtgaactctgtagtggatttcttcacggtgccccccgtgtttgtg
tctgtgtacttaaacagaagttggcttggtttgagatttttaagagctctgagactgata
cagttttcagaaattttgcagtttctgaatattcttaaaacaagtaattccatcaagctg
gtgaatctgctctccatatttatcagcacgtggctgactgcagccgggttcatccatttg
gtggagaattcaggggacccatgggaaaatttccaaaacaaccaggctctcacctactgg
gaatgtgtctatttactcatggtcacaatgtccaccgttggttatggggatgtttatgca
aaaaccacacttgggcgcctcttcatggtcttcttcatcctcgggggactggccatgttt
gccagctacgtccctgaaatcatagagttaataggaaaccgcaagaaatacgggggctcc
tatagtgcggttagtggaagaaagcacattgtggtctgcggacacatcactctggagagt
gtttccaacttcctgaaggactttctgcacaaggaccgggatgacgtcaatgtggagatc
gtttttcttcacaacatctcccccaacctggagcttgaagctctgttcaaacgacatttt
actcaggtggaattttatcagggttccgtcctcaatccacatgatcttgcaagagtcaag
atagagtcagcagatgcatgcctgatccttgccaacaagtactgcgctgacccggatgcg
gaggatgcctcgaatatcatgagagtaatctccataaagaactaccatccgaagataaga
atcatcactcaaatgctgcagtatcacaacaaggcccatctgctaaacatcccgagctgg
aattggaaagaaggtgatgacgcaatctgcctcgcagagttgaagttgggcttcatagcc
cagagctgcctggctcaaggcctctccaccatgcttgccaacctcttctccatgaggtca
ttcataaagattgaggaagacacatggcagaaatactacttggaaggagtctcaaatgaa
atgtacacagaatatctctccagtgccttcgtgggtctgtccttccctactgtttgtgag
ctgtgttttgtgaagctcaagctcctaatgatagccattgagtacaagtctgccaaccga
gagagccgtatattaattaatcctggaaaccatcttaagatccaagaaggtactttagga
tttttcatcgcaagtgatgccaaagaagttaaaagggcatttttttactgcaaggcctgt
catgatgacatcacagatcccaaaagaataaaaaaatgtggctgcaaacggcccaagatg
tccatctacaagagaatgagacgggcatgttgttttgattgcggacgttctgagcgtgac
tgctcatgcatgtcaggccgtgtgcgtggtaacgtggacacccttgagagagccttccca
ctttcttctgtctctgttaatgattgctccaccagtttccgtgcctttgaagatgagcag
ccgtcaacactatcaccaaaaaaaaagcaacggaatggaggcatgcggaactcacccaac
acctcgcctaagctgatgaggcatgaccccttgttaattcctggcaatgatcagattgac
aacatggactccaatgtgaagaagtacgactctactgggatgtttcactggtgtgcaccc
aaggagatagagaaagtcatcctgactcgaagtgaagctgccatgaccgtcctgagtggc
catgtcgtggtctgcatctttggcgacgtcagctcagccctgatcggcctccggaacctg
gtgatgccgctccgtgccagcaactttcattaccatgagctcaagcacattgtgtttgtg
ggctctattgagtacctcaagcgggaatgggagacgcttcataacttccccaaagtgtcc
atattgcctggtacgccattaagtcgggctgatttaagggctgtcaacatcaacctctgt
gacatgtgcgttatcctgtcagccaatcagaataatattgatgatacttcgctgcaggac
aaggaatgcatcttggcgtcactcaacatcaaatctatgcagtttgatgacagcatcgga
gtcttgcaggctaattcccaagggttcacacctccaggaatggatagatcctctccagat
aacagcccagtgcacgggatgttacgtcaaccatccatcacaactggggtcaacatcccc
atcatcactgaactagtgaacgatactaatgttcagtttttggaccaagacgatgatgat
gaccctgatacagaactgtacctcacgcagccctttgcctgtgggacagcatttgccgtc
agtgtcctggactcactcatgagcgcgacgtacttcaatgacaatatcctcaccctgata
cggaccctggtgaccggaggagccacgccggagctggaggctctgattgctgaggaaaac
gcccttagaggtggctacagcaccccgcagacactggccaatagggaccgctgccgcgtg
gcccagttagctctgctcgatgggccatttgcggacttaggggatggtggttgttatggt
gatctgttctgcaaagctctgaaaacatataatatgctttgttttggaatttaccggctg
agagatgctcacctcagcacccccagtcagtgcacaaagaggtatgtcatcaccaacccg
ccctatgagtttgagctcgtgccgacggacctgatcttctgcttaatgcagtttgaccac
aatgccggccagtcccgggccagcctgtcccattcctcccactcgtcgcagtcctccagc
aagaagagctcctctgttcactccatcccatccacagcaaaccgacagaaccggcccaag
tccagggagtcccgggacaaacagaagtacgtgcaggaagagcggctttga

KEGG   Homo sapiens (human): 3779
Entry
3779              CDS       T01001                                 

Gene name
KCNMB1, BKbeta1, K(VCA)beta, SLO-BETA, hbeta1, hslo-beta, k(VCA)beta-1, slo-beta-1
Definition
(RefSeq) potassium calcium-activated channel subfamily M regulatory beta subunit 1
  KO
K04937  potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04911  Insulin secretion
Drug target
Flindokalner: D04192
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    3779 (KCNMB1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    3779 (KCNMB1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    3779 (KCNMB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3779 (KCNMB1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   3779 (KCNMB1)
SSDB
Motif
Pfam: CaKB UL41A
Other DBs
NCBI-GeneID: 3779
NCBI-ProteinID: NP_004128
OMIM: 603951
HGNC: 6285
Ensembl: ENSG00000145936
Vega: OTTHUMG00000130439
Pharos: Q16558(Tbio)
UniProt: Q16558
LinkDB
Position
5q35.1
AA seq 191 aa
MVKKLVMAQKRGETRALCLGVTMVVCAVITYYILVTTVLPLYQKSVWTQESKCHLIETNI
RDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQCSYIPGSVDNYQTARADV
EKVRAKFQEQQVFYCFSAPRGNETSVLFQRLYGPQALLFSLFWPTFLLTGGLLIIAMVKS
NQYLSILAAQK
NT seq 576 nt   +upstreamnt  +downstreamnt
atggtgaagaagctggtgatggcccagaagcggggagagacacgagccctttgcctgggt
gtaaccatggtggtgtgtgccgtcatcacctactacatcctggtcacgactgtgctgccc
ctctaccagaaaagcgtgtggacccaggaatccaagtgccacctgattgagaccaacatc
agggaccaggaggagctgaagggcaagaaggtgccccagtacccatgcctgtgggtcaac
gtgtcagctgccggcaggtgggctgtgctgtaccacacggaggacactcgggaccagaac
cagcagtgctcctacatcccaggcagcgtggacaattaccagacggcccgggccgacgtg
gagaaggtcagagccaaattccaagagcagcaggtcttctactgcttctccgcacctcgg
gggaacgaaaccagcgtcctattccagcgcctctacgggccccaggccctcctcttctcc
ctcttctggcccaccttcctgctgaccggtggcctcctcattatcgccatggtgaagagc
aaccagtacctgtccatcctggcggcccagaagtag

DBGET integrated database retrieval system