KEGG   Homo sapiens (human): 1025Help
Entry
1025              CDS       T01001                                 

Gene name
CDK9, C-2k, CDC2L4, CTK1, PITALRE, TAK
Definition
(RefSeq) cyclin dependent kinase 9
  KO
K02211  cyclin-dependent kinase 9 [EC:2.7.11.22 2.7.11.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
Drug target
Dinaciclib: D09604
Zotiraciclib (DG03058): D11599 D11600
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    1025 (CDK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1025 (CDK9)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    1025 (CDK9)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     1025 (CDK9)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     1025 (CDK9)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   1025 (CDK9)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     1025 (CDK9)
    Brd4/P-TEFb complex
     1025 (CDK9)
    7SK RNP complex
     1025 (CDK9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 1025
NCBI-ProteinID: NP_001252
OMIM: 603251
HGNC: 1780
Ensembl: ENSG00000136807
Vega: OTTHUMG00000020715
Pharos: P50750(Tchem)
UniProt: P50750 A0A024R880
LinkDB All DBs
Structure
PDB: 

Position
9q34.11
AA seq 372 aa AA seqDB search
MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFP
ITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVK
FTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNS
QPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLAL
ISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDP
AQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNP
ATTNQTEFERVF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcagtacgactcggtggagtgccctttttgtgatgaagtttccaaatacgag
aagctcgccaagatcggccaaggcaccttcggggaggtgttcaaggccaggcaccgcaag
accggccagaaggtggctctgaagaaggtgctgatggaaaacgagaaggaggggttcccc
attacagccttgcgggagatcaagatccttcagcttctaaaacacgagaatgtggtcaac
ttgattgagatttgtcgaaccaaagcttccccctataaccgctgcaagggtagtatatac
ctggtgttcgacttctgcgagcatgaccttgctgggctgttgagcaatgttttggtcaag
ttcacgctgtctgagatcaagagggtgatgcagatgctgcttaacggcctctactacatc
cacagaaacaagatcctgcatagggacatgaaggctgctaatgtgcttatcactcgtgat
ggggtcctgaagctggcagactttgggctggcccgggccttcagcctggccaagaacagc
cagcccaaccgctacaccaaccgtgtggtgacactctggtaccggcccccggagctgttg
ctcggggagcgggactacggcccccccattgacctgtggggtgctgggtgcatcatggca
gagatgtggacccgcagccccatcatgcagggcaacacggagcagcaccaactcgccctc
atcagtcagctctgcggctccatcacccctgaggtgtggccaaacgtggacaactatgag
ctgtacgaaaagctggagctggtcaagggccagaagcggaaggtgaaggacaggctgaag
gcctatgtgcgtgacccatacgcactggacctcatcgacaagctgctggtgctggaccct
gcccagcgcatcgacagcgatgacgccctcaaccacgacttcttctggtccgaccccatg
ccctccgacctcaagggcatgctctccacccacctgacgtccatgttcgagtacttggca
ccaccgcgccggaagggcagccagatcacccagcagtccaccaaccagagtcgcaatccc
gccaccaccaaccagacggagtttgagcgcgtcttctga

KEGG   Homo sapiens (human): 904Help
Entry
904               CDS       T01001                                 

Gene name
CCNT1, CCNT, CYCT1, HIVE1
Definition
(RefSeq) cyclin T1
  KO
K15188  cyclin T
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    904 (CCNT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    904 (CCNT1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     904 (CCNT1)
    Brd4/P-TEFb complex
     904 (CCNT1)
    7SK RNP complex
     904 (CCNT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N
Motif
Other DBs
NCBI-GeneID: 904
NCBI-ProteinID: NP_001231
OMIM: 143055
HGNC: 1599
Ensembl: ENSG00000129315
Vega: OTTHUMG00000170393
Pharos: O60563(Tchem)
UniProt: O60563
LinkDB All DBs
Structure
PDB: 

Position
12q13.11-q13.12
AA seq 726 aa AA seqDB search
MEGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQRLNVSQLTIN
TAIVYMHRFYMIQSFTQFPGNSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPD
TRSEAYLQQVQDLVILESIILQTLGFELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATN
SLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHE
FLQILEKTPNRLKRIWNWRACEAAKKTKADDRGTDEKTSEQTILNMISQSSSDTTIAGLM
SMSTSTTSAVPSLPVSEESSSNLTSVEMLPGKRWLSSQPSFKLEPTQGHRTSENLALTGV
DHSLPQDGSNAFISQKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENMEANVKSQYAY
AAQNLLSHHDSHSSVILKMPIEGSENPERPFLEKADKTALKMRIPVAGGDKAASSKPEEI
KMRIKVHAAADKHNSVEDSVTKSREHKEKHKTHPSNHHHHHNHHSHKHSHSQLPVGTGNK
RPGDPKHSSQTSNLAHKTYSLSSSFSSSSSTRKRGPSEETGGAVFDHPAKIAKSTKSSSL
NFSFPSLPTMGQMPGHSSDTSGLSFSQPSCKTRVPHSKLDKGPTGANGHNTTQTIDYQDT
VNMLHSLLSAQGVQPTQPTAFEFVRPYSDYLNPRSGGISSRSGNTDKPRPPPLPSEPPPP
LPPLPK
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggagggagagaggaagaacaacaacaaacggtggtatttcactcgagaacagctggaa
aatagcccatcccgtcgttttggcgtggacccagataaagaactttcttatcgccagcag
gcggccaatctgcttcaggacatggggcagcgtcttaacgtctcacaattgactatcaac
actgctatagtatacatgcatcgattctacatgattcagtccttcacacagttccctgga
aattctgtggctccagcagccttgtttctagcagctaaagtggaggagcagcccaaaaaa
ttggaacatgtcatcaaggtagcacatacttgtctccatcctcaggaatcccttcctgat
actagaagtgaggcttatttgcaacaagttcaagatctggtcattttagaaagcataatt
ttgcagactttaggctttgaactaacaattgatcacccacatactcatgtagtaaagtgc
actcaacttgttcgagcaagcaaggacttagcacagacttcttacttcatggcaaccaac
agcctgcatttgaccacatttagcctgcagtacacacctcctgtggtggcctgtgtctgc
attcacctggcttgcaagtggtccaattgggagatcccagtctcaactgacgggaagcac
tggtgggagtatgttgacgccactgtgaccttggaacttttagatgaactgacacatgag
tttctacagattttggagaaaactcccaacaggctcaaacgcatttggaattggagggca
tgcgaggctgccaagaaaacaaaagcagatgaccgaggaacagatgaaaagacttcagag
cagacaatcctcaatatgatttcccagagctcttcagacacaaccattgcaggtttaatg
agcatgtcaacttctaccacaagtgcagtgccttccctgccagtctccgaagagtcatcc
agcaacttaaccagtgtggagatgttgccgggcaagcgttggctgtcctcccaaccttct
ttcaaactagaacctactcagggtcatcggactagtgagaatttagcacttacaggagtt
gatcattccttaccacaggatggttcaaatgcatttatttcccagaagcagaatagtaag
agtgtgccatcagctaaagtgtcactgaaagaataccgcgcgaagcatgcagaagaattg
gctgcccagaagaggcaactggagaacatggaagccaatgtgaagtcacaatatgcatat
gctgcccagaatctcctttctcatcatgatagccattcttcagtcattctaaaaatgccc
atagagggttcagaaaaccccgagcggccttttctggaaaaggctgacaaaacagctctc
aaaatgagaatcccagtggcaggtggagataaagctgcgtcttcaaaaccagaggagata
aaaatgcgcataaaagtccatgctgcagctgataagcacaattctgtagaggacagtgtt
acaaagagccgagagcacaaagaaaagcacaagactcacccatctaatcatcatcatcat
cataatcaccactcacacaagcactctcattcccaacttccagttggtactgggaacaaa
cgtcctggtgatccaaaacatagtagccagacaagcaacttagcacataaaacctatagc
ttgtctagttctttttcctcttccagttctactcgtaaaaggggaccctctgaagagact
ggaggggctgtgtttgatcatccagccaagattgccaagagtactaaatcctcttcccta
aatttctccttcccttcacttcctacaatgggtcagatgcctgggcatagctcagacaca
agtggcctttccttttcacagcccagctgtaaaactcgtgtccctcattcgaaactggat
aaagggcccactggggccaatggtcacaacacgacccagacaatagactatcaagacact
gtgaatatgcttcactccctgctcagtgcccagggtgttcagcccactcagcccactgca
tttgaatttgttcgtccttatagtgactatctgaatcctcggtctggtggaatctcctcg
agatctggcaatacagacaaaccccggccaccacctctgccatcagaacctcctccacca
cttccaccccttcctaagtaa

KEGG   Homo sapiens (human): 905Help
Entry
905               CDS       T01001                                 

Gene name
CCNT2, CYCT2
Definition
(RefSeq) cyclin T2
  KO
K15188  cyclin T
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    905 (CCNT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    905 (CCNT2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     905 (CCNT2)
    Brd4/P-TEFb complex
     905 (CCNT2)
    7SK RNP complex
     905 (CCNT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N
Motif
Other DBs
NCBI-GeneID: 905
NCBI-ProteinID: NP_490595
OMIM: 603862
HGNC: 1600
Ensembl: ENSG00000082258
Vega: OTTHUMG00000131712
Pharos: O60583(Tbio)
UniProt: O60583 B4DH21
LinkDB All DBs
Structure
PDB: 

Position
2q21.3
AA seq 730 aa AA seqDB search
MASGRGASSRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINT
AIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPLEPLLDT
KCDAYLQQTQELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNS
LHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPTVTLELLDELTHEF
LQILEKTPNRLKKIRNWRANQAARKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPTNPS
FQKPSTSAFPAPVPLNSGNISVQDSHTSDNLSMLATGMPSTSYGLSSHQEWPQHQDSART
EQLYSQKQETSLSGSQYNINFQQGPSISLHSGLHHRPDKISDHSSVKQEYTHKAGSSKHH
GPISTTPGIIPQKMSLDKYREKRKLETLDLDVRDHYIAAQVEQQHKQGQSQAASSSSVTS
PIKMKIPIANTEKYMADKKEKSGSLKLRIPIPPTDKSASKEELKMKIKVSSSERHSSSDE
GSGKSKHSSPHISRDHKEKHKEHPSSRHHTSSHKHSHSHSGSSSGGSKHSADGIPPTVLR
SPVGLSSDGISSSSSSSRKRLHVNDASHNHHSKMSKSSKSSGSSSSSSSSVKQYISSHNS
VFNHPLPPPPPVTYQVGYGHLSTLVKLDKKPVETNGPDANHEYSTSSQHMDYKDTFDMLD
SLLSAQGMNM
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgggccgtggagcttcttctcgctggttctttactcgggaacagctggagaac
acgccgagccgccgctgcggagtggaggcggataaagagctctcgtgccgccagcaggcg
gccaacctcatccaggagatgggacagcgtctcaatgtctctcagcttacaataaacact
gcgattgtttatatgcacaggttttatatgcaccattctttcaccaaattcaacaaaaat
ataatatcgtctactgcattatttttggctgcaaaagtggaagaacaggctcgaaaactt
gaacatgttatcaaagtagcacatgcttgtcttcatcctctagagccactgctggatact
aaatgtgatgcttaccttcaacagactcaagaactggttatacttgaaaccataatgcta
caaactctaggttttgagatcaccattgaacacccacacacagatgtggtgaaatgtacc
cagttagtaagagcaagcaaggatttggcacagacatcctatttcatggctaccaacagt
ctgcatcttacaaccttctgtcttcagtacaaaccaacagtgatagcatgtgtatgcatt
catttggcttgcaaatggtccaattgggagatccctgtatcaactgatggaaagcattgg
tgggaatatgtggatcctacagttactctagaattattagatgagctaacacatgagttt
ctacaaatattggagaaaacgcctaataggttgaagaagattcgaaactggagggctaat
caggcagctaggaaaccaaaagtagatggacaggtatcagagacaccacttcttggttca
tctttggtccagaattccattttagtagatagtgtcactggtgtgcctacaaacccaagt
tttcagaaaccatctacatcagcattccctgcgccagtacctctaaattcaggaaatatt
tctgttcaagacagccatacatctgataatttgtcaatgctagcaacaggaatgccaagt
acttcatacggtttatcatcacaccaggaatggcctcaacatcaagactcagcaaggaca
gaacagctatattcacagaaacaggagacatctttgtctggtagccagtacaacatcaac
ttccagcagggaccttctatatcactgcattcaggattacatcacagacctgacaaaatt
tcagatcattcttctgttaagcaagaatatactcataaagcagggagcagtaaacaccat
gggccaatttccactactccaggaataattcctcagaaaatgtctttagataaatataga
gaaaagcgtaaactagaaactcttgatctcgatgtaagggatcattatatagctgcccag
gtagaacagcagcacaaacaagggcagtcacaggcagccagcagcagttctgttacttct
cccattaaaatgaaaatacctatcgcaaatactgaaaaatacatggcagacaaaaaggaa
aagagtgggtcactgaaattacggattccaataccacccactgataaaagcgccagtaaa
gaagaactgaaaatgaaaataaaagtttcttcttcagaaagacacagctcttctgatgaa
ggcagtgggaagagcaaacattcaagcccacatattagcagagaccataaggagaagcac
aaggagcatccttcaagccgccaccacaccagcagccacaagcattcccactcgcatagt
ggcagcagcagcggtggcagtaaacacagtgccgacggaataccacccactgttctgagg
agtcctgttggcctgagcagtgatggcatttcctctagctccagctcttcaaggaagagg
ctgcatgtcaatgatgcatctcacaaccaccactccaaaatgagcaaaagttccaaaagt
tcaggtagttcatctagttcttcctcctctgttaagcagtatatatcctctcacaactct
gtttttaaccatcccttaccccctcctccccctgtcacataccaggtgggctacggacat
ctcagcaccctcgtgaaactggacaagaagccagtggagaccaacggtcctgatgccaat
cacgagtacagtacaagcagccagcatatggactacaaagacacattcgacatgctggac
tcactgttaagtgcccaaggaatgaacatgtaa

KEGG   Homo sapiens (human): 4298Help
Entry
4298              CDS       T01001                                 

Gene name
MLLT1, ENL, LTG19, YEATS1
Definition
(RefSeq) MLLT1 super elongation complex subunit
  KO
K15187  YEATS domain-containing protein 1/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
N00120  MLL-ENL fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    4298 (MLLT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    4298 (MLLT1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    4298 (MLLT1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     4298 (MLLT1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    Dot1-containing complex
     4298 (MLLT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AHD YEATS
Motif
Other DBs
NCBI-GeneID: 4298
NCBI-ProteinID: NP_005925
OMIM: 159556
HGNC: 7134
Ensembl: ENSG00000130382
Vega: OTTHUMG00000180757
Pharos: Q03111(Tbio)
UniProt: Q03111
LinkDB All DBs
Structure
PDB: 

Position
19p13.3
AA seq 559 aa AA seqDB search
MDNQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFWLHDSFP
KPRRVCKEPPYKVEESGYAGFIMPIEVHFKNKEEPRKVCFTYDLFLNLEGNPPVNHLRCE
KLTFNNPTTEFRYKLLRAGGVMVMPEGADTVSRPSPDYPMLPTIPLSAFSDPKKTKPSHG
SKDANKESSKTSKPHKVTKEHRERPRKDSESKSSSKELEREQAKSSKDTSRKLGEGRLPK
EEKAPPPKAAFKEPKMALKETKLESTSPKGGPPPPPPPPPRASSKRPATADSPKPSAKKQ
KKSSSKGSRSAPGTSPRTSSSSSFSDKKPAKDKSSTRGEKVKAESEPREAKKALEVEESN
SEDEASFKSESAQSSPSNSSSSSDSSSDSDFEPSQNHSQGPLRSMVEDLQSEESDEDDSS
SGEEAAGKTNPGRDSRLSFSDSESDNSADSSLPSREPPPPQKPPPPNSKVSGRRSPESCS
KPEKILKKGTYDKAYTDELVELHRRLMALRERNVLQQIVNLIEETGHFNVTNTTFDFDLF
SLDETTVRKLQSCLEAVAT
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggacaatcagtgcaccgtccaggtgaggttagagctggggcatcgcgcccaactgcgc
aagaagcccaccacggaggggttcactcacgactggatggtgtttgtccgcggccccgag
caatgtgacatccagcacttcgtggagaaggtggtcttctggctgcacgacagcttcccc
aagcccagacgcgtgtgcaaggagcccccctacaaagtagaggagtcggggtacgctggc
ttcatcatgcccatcgaggtgcacttcaaaaacaaggaggagccgaggaaggtctgcttc
acctacgacctgttcctgaacctggaaggcaacccgcccgtgaaccacctgcgctgcgag
aagctcaccttcaacaaccccaccacggagttccggtacaagctcctgcgggccggcggg
gtgatggtaatgcccgaaggagcagacacggtgtccaggcccagtcccgactaccccatg
ttacccacaattccactctctgccttctctgaccccaagaagaccaaaccatcccacggc
tccaaggacgccaacaaggagagcagcaagacctccaagccacacaaggtgaccaaggag
caccgggagcggccccgcaaagactccgagagcaagagctcctccaaggagctggagcgt
gagcaggccaaaagctccaaggacacctcgcggaagctgggcgagggccggctgcccaag
gaggagaaggcgccaccgcccaaggctgccttcaaggaacccaagatggccctgaaagag
accaagctggaaagcacgtcccccaagggtgggcccccacccccacccccacccccaccc
cgggcttccagcaagcggccggccaccgccgactcgccaaagcccagcgccaagaagcag
aagaagagcagctcgaaggggtcccggagtgctccaggcacctcgccccgcacctcctcc
tcctcctccttctcggacaagaagccggccaaggacaagagcagcaccagaggggagaag
gtgaaggccgagagtgagccccgggaggccaaaaaggccctggaggtggaggagtccaac
tcagaggacgaggcctccttcaagtccgagtctgcccagtcaagcccgtccaactccagc
tccagctcagactccagctcagactcagacttcgagccatcccagaaccacagccaagga
cccctgcgctccatggtggaggacctgcagtccgaggagtccgacgaggacgactcttcg
tcaggcgaggaggctgccggcaagaccaacccggggagggactccaggttgagcttcagc
gacagcgagagtgacaacagcgccgactcctccctgcccagccgtgagcccccacccccc
cagaagccacccccgcccaacagcaaggtgtcaggccggaggagccccgagtcctgcagc
aagcctgagaagatcctcaagaagggcacctacgacaaggcctacacggatgagctggtg
gagctacaccggaggctgatggcgctgcgggagcgcaacgtgctgcagcagattgtgaat
ctgatcgaggagactggccacttcaatgtcaccaacaccaccttcgacttcgacctcttc
tccctggacgagaccaccgtgcgcaaactgcagagctgcctggaggccgtggccacatga

KEGG   Homo sapiens (human): 4300Help
Entry
4300              CDS       T01001                                 

Gene name
MLLT3, AF9, YEATS3
Definition
(RefSeq) MLLT3 super elongation complex subunit
  KO
K15187  YEATS domain-containing protein 1/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    4300 (MLLT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    4300 (MLLT3)
   03036 Chromosome and associated proteins [BR:hsa03036]
    4300 (MLLT3)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     4300 (MLLT3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    Dot1-containing complex
     4300 (MLLT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AHD YEATS BET
Motif
Other DBs
NCBI-GeneID: 4300
NCBI-ProteinID: NP_004520
OMIM: 159558
HGNC: 7136
Ensembl: ENSG00000171843
Vega: OTTHUMG00000019650
Pharos: P42568(Tbio)
UniProt: P42568 A0A0S2Z448
LinkDB All DBs
Structure
PDB: 

Position
9p21.3
AA seq 568 aa AA seqDB search
MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFP
RPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCE
KLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS
SSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKESSKKPKENK
PLKEEKIVPKMAFKEPKPMSKEPKPDSNLLTITSGQDKKAPSKRPPISDSEELSAKKRKK
SSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKSTLPPFDDIVD
PNDSDVEENISSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESD
EVEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILE
VKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITN
TTFDFDLCSLDKTTVRKLQSYLETSGTS
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggctagctcgtgtgccgtgcaggtgaagctggagctggggcaccgcgcccaggtgagg
aaaaaacccaccgtggagggcttcacccacgactggatggtgttcgtacgcggtccggag
cacagtaacatacagcactttgtggagaaagtcgtcttccacttgcacgaaagctttcct
aggccaaaaagagtgtgcaaagatccaccttacaaagtagaagaatctgggtatgctggt
ttcattttgccaattgaagtttattttaaaaacaaggaagaacctaggaaagtccgcttt
gattatgacttattcctgcatcttgaaggccatccaccagtgaatcacctccgctgtgaa
aagctaactttcaacaaccccacagaggactttaggagaaagttgctgaaggcaggaggg
gaccctaataggagtattcataccagcagcagcagcagcagcagcagtagcagcagcagc
agcagcagcagcagcagcagtagcagcagcagcagcagcagcagcagcagcagtagcagc
agcagtagcagcagcagcagcagcagtagtaccagtttttcaaagcctcacaaattaatg
aaggagcacaaggaaaaaccttctaaagactccagagaacataaaagtgccttcaaagaa
ccttccagggatcacaacaaatcttccaaagaatcctctaagaaacccaaagaaaataaa
ccactgaaagaagagaaaatagttcctaagatggccttcaaggaacctaaacccatgtca
aaagagccaaaaccagatagtaacttactcaccatcaccagtggacaagataagaaggct
cctagtaaaaggccgcccatttcagattctgaagaactctcagccaaaaaaaggaaaaag
agtagctcagaggctttatttaaaagtttttctagcgcaccaccactgatactcacttgt
tctgctgacaaaaaacagataaaagataaatctcatgtcaagatgggaaaggtcaaaatt
gaaagtgagacatcagagaagaagaaatcaacgttaccgccatttgatgatattgtggat
cccaatgattcagatgtggaggagaatatatcctctaaatctgattctgaacaacccagt
cctgccagctccagctccagctccagctccagcttcacaccatcccagaccaggcaacaa
ggtcctttgaggtctataatgaaagatctgcattctgatgacaatgaggaggaatcagat
gaagtggaggataacgacaatgactctgaaatggagaggcctgtaaatagaggaggcagc
cgaagtcgcagagttagcttaagtgatggcagcgatagtgaaagcagttctgcttcttca
cccctacatcacgaacctccaccacccttactaaaaaccaacaacaaccagattcttgaa
gtgaaaagtccaataaagcaaagcaaatcagataagcaaataaagaatggtgaatgtgac
aaggcatacctagatgaactggtagagcttcacagaaggttaatgacattgagagaaaga
cacattctgcagcagatcgtgaaccttatagaagaaactggacactttcatatcacaaac
acaacatttgattttgatctttgctcgctggacaaaaccacagtccgtaaactacagagt
tacctggaaacatctggaacatcctga

KEGG   Homo sapiens (human): 84444Help
Entry
84444             CDS       T01001                                 

Gene name
DOT1L, DOT1, KMT4
Definition
(RefSeq) DOT1 like histone lysine methyltransferase
  KO
K11427  [histone H3]-lysine79 N-trimethyltransferase [EC:2.1.1.360]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00310  Lysine degradation
hsa01100  Metabolic pathways
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    84444 (DOT1L)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    84444 (DOT1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    84444 (DOT1L)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.360  [histone H3]-lysine79 N-trimethyltransferase
     84444 (DOT1L)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     84444 (DOT1L)
   HMT complexes
    Dot1-containing complex
     84444 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1
Motif
Other DBs
NCBI-GeneID: 84444
NCBI-ProteinID: NP_115871
OMIM: 607375
HGNC: 24948
Ensembl: ENSG00000104885
Vega: OTTHUMG00000150431
Pharos: Q8TEK3(Tchem)
UniProt: Q8TEK3
LinkDB All DBs
Structure
PDB: 

Position
19p13.3
AA seq 1537 aa AA seqDB search
MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVL
IDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVT
DPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCK
HHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFV
NNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLK
GSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRESKSNAATPTKGP
EGKVAGPADAPMDSGAEEEKAGAATVKKPSPSKARKKKLNKKGRKMAGRKRGRPKKMNTA
NPERKPKKNQTALDALHAQTVSQTAASSPQDAYRSPHSPFYQLPPSVQRHSPNPLLVAPT
PPALQKLLESFKIQYLQFLAYTKTPQYKASLQELLGQEKEKNAQLLGAAQQLLSHCQAQK
EEIRRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLREQSEQLEQDNRALRGQSLQLL
KARCEELQLDWATLSLEKLLKEKQALKSQISEKQRHCLELQISIVELEKSQRQQELLQLK
SCVPPDDALSLHLRGKGALGRELEPDASRLHLELDCTKFSLPHLSSMSPELSMNGQAAGY
ELCGVLSRPSSKQNTPQYLASPLDQEVVPCTPSHVGRPRLEKLSGLAAPDYTRLSPAKIV
LRRHLSQDHTVPGRPAASELHSRAEHTKENGLPYQSPSVPGSMKLSPQDPRPLSPGALQL
AGEKSSEKGLRERAYGSSGELITSLPISIPLSTVQPNKLPVSIPLASVVLPSRAERARST
PSPVLQPRDPSSTLEKQIGANAHGAGSRSLALAPAGFSYAGSVAISGALAGSPASLTPGA
EPATLDESSSSGSLFATVGSRSSTPQHPLLLAQPRNSLPASPAHQLSSSPRLGGAAQGPL
PEASKGDLPSDSGFSDPESEAKRRIVFTITTGAGSAKQSPSSKHSPLTASARGDCVPSHG
QDSRRRGRRKRASAGTPSLSAGVSPKRRALPSVAGLFTQPSGSPLNLNSMVSNINQPLEI
TAISSPETSLKSSPVPYQDHDQPPVLKKERPLSQTNGAHYSPLTSDEEPGSEDEPSSARI
ERKIATISLESKSPPKTLENGGGLAGRKPAPAGEPVNSSKWKSTFSPISDIGLAKSADSP
LQASSALSQNSLFTFRPALEEPSADAKLAAHPRKGFPGSLSGADGLSPGTNPANGCTFGG
GLAADLSLHSFSDGASLPHKGPEAAGLSSPLSFPSQRGKEGSDANPFLSKRQLDGLAGLK
GEGSRGKEAGEGGLPLCGPTDKTPLLSGKAAKARDREVDLKNGHNLFISAAAVPPGSLLS
GPGLAPAASSAGGAASSAQTHRSFLGPFPPGPQFALGPMSLQANLGSVAGSSVLQSLFSS
VPAAAGLVHVSSAATRLTNSHAMGSFSGVAGGTVGGN
NT seq 4614 nt NT seq  +upstreamnt  +downstreamnt
atgggggagaagctggagctgagactgaagtcgcccgtgggggctgagcccgccgtctac
ccgtggccgctgccggtctacgataaacatcacgatgctgctcatgaaatcatcgagacc
atccgatgggtctgtgaagaaatcccggatctcaagctcgctatggagaattacgtttta
attgactatgacaccaaaagcttcgagagcatgcagaggctctgcgacaagtacaaccgt
gccatcgacagcatccaccagctgtggaagggcaccacgcagcccatgaagctgaacacg
cggccgtccactggactcctgcgccatatcctgcagcaggtctacaaccactcggtgacc
gaccccgagaagctcaacaactacgagcccttctcccccgaggtgtacggggagacctcc
ttcgacctggtggcccagatgattgatgagatcaagatgaccgacgacgacctgtttgtg
gacttggggagcggtgtgggccaggtcgtgctccaggttgctgctgccaccaactgcaaa
catcactatggcgtcgagaaagcagacatcccggccaagtatgcggagaccatggaccgc
gagttcaggaagtggatgaaatggtatggaaaaaagcatgcagaatacacattggagaga
ggcgatttcctctcagaagagtggagggagcgaatcgccaacacgagtgttatatttgtg
aataattttgcctttggtcctgaggtggatcaccagctgaaggagcggtttgcaaacatg
aaggaaggtggcagaatcgtgtcctcgaaaccctttgcacctctgaacttcagaataaac
agtagaaacttgagtgacatcggcaccatcatgcgcgtggtggagctctcgcccctgaag
ggctcggtgtcgtggacggggaagccagtctcctactacctgcacactatcgaccgcacc
atacttgaaaactatttttctagtctgaaaaacccaaaactcagggaggaacaggaggca
gcccggcgccgccagcagcgcgagagcaagagcaacgcggccacgcccactaagggccca
gagggcaaggtggccggccccgccgacgcccccatggactctggtgctgaggaagagaag
gcgggagcagccaccgtgaagaagccgtctccctccaaagcccgcaagaagaagctaaac
aagaaggggaggaagatggctggccgcaagcgcgggcgccccaagaagatgaacactgcg
aaccccgagcggaagcccaagaagaaccaaactgcactggatgccctgcacgctcagacc
gtgtctcagacggcggcctcctcaccccaggatgcctacagatcccctcacagcccgttc
taccagctacctccgagcgtgcagcggcactcccccaacccgctgctggtggcgcccacc
ccgcccgcgctgcagaagcttctagagtccttcaagatccagtacctgcagttcctggca
tacacaaagaccccccagtacaaggccagcctgcaggagctgctgggccaggagaaggag
aagaacgcccagctcctgggtgcggctcagcagctcctcagccactgccaggcccagaag
gaggagatcaggaggctgtttcagcaaaaattggatgagctgggtgtgaaggcgctgacc
tacaacgacctgattcaagcgcagaaggagatctccgcccataaccagcagctgcgggag
cagtcggagcagctggagcaggacaaccgcgcgctccgcggccagagcttgcagctgctc
aaggctcgctgcgaggagctgcagctggactgggccacgctgtcgctggagaagctgttg
aaggagaagcaggccctgaagagccagatctcggagaagcagaggcactgcctggagctg
cagatcagcattgtggagctagagaagagccagcggcagcaggagctcctgcagctcaag
tcctgtgtgccgcctgacgacgccctgtccctgcacctgcgtgggaagggcgccctgggc
cgcgagctggagcctgacgccagccggctgcacctggagctggactgcaccaagttctcg
ctgcctcacttgagcagcatgagcccggagctctccatgaacggccaggctgctggctat
gagctctgcggtgtgctgagccggccttcgtcgaagcagaacacgccccagtacctggcc
tcacccctggaccaggaggtggtgccctgtacccctagccacgtcggccggccgcgcctg
gagaagctgtctggcctagccgcacccgactacactaggctgtccccggccaagattgtg
ctgaggcggcacctgagccaggaccacacggtgcccggcaggccggctgccagtgagctg
cattcgagagctgagcacaccaaggagaacggccttccctaccagagccccagcgtgcct
ggcagcatgaagctgagccctcaggacccgcggcccctgtcccctggggccttgcagctt
gctggagagaagagcagtgagaagggcctgagagagcgcgcctacggcagcagcggggag
ctcatcaccagcctgcccatcagcatcccgctcagcaccgtgcagcccaacaagctcccg
gtcagcattcccctggccagcgtggtgctgcccagccgcgccgagagggcgaggagcacc
cccagtcccgtgctgcagccccgtgacccctcgtccacacttgaaaagcagattggtgct
aatgcccacggtgctgggagcagaagccttgccctggcccccgcaggcttctcctacgct
ggctcggtggccatcagcggggccttggcgggcagcccggcctctctcacacctggagcc
gagccggccaccttggatgagtcctccagctctgggagcctttttgccaccgtggggtcc
cgcagctccacgccacagcaccccctgctgctggcacagccccggaactcgcttcctgcc
tctcccgcccaccagctctcctccagtccccggcttggtggggccgcccagggcccgttg
cccgaggccagcaagggagacctgccctccgattccggcttctcagatcctgagagtgaa
gccaagaggaggattgtgttcaccatcaccactggtgcgggcagtgccaagcagtcgccc
tccagcaagcacagccccctgaccgccagcgcccgtggggactgtgtgccgagccacggg
caggacagtcgcaggcgcggccggcggaagcgagcatctgcggggacgcccagcttgagc
gcaggcgtgtcccccaagcgccgagccctgccgtccgtcgctggccttttcacacagcct
tcggggtctcccctcaacctcaactccatggtcagtaacatcaaccagcccctggagatt
acagccatctcgtccccggagacctccctgaagagctcccctgtgccctaccaggaccac
gaccagccccccgtgctcaagaaggagcggcctctgagccagaccaatggggcacactac
tccccactcacctcagacgaggagccaggctctgaggacgagcccagcagtgctcgaatt
gagagaaaaattgcaacaatctccttagaaagcaaatctcccccgaaaaccttggaaaat
ggtggtggcttggcgggaaggaagcccgcgcccgccggcgagccagtcaatagcagcaag
tggaagtccaccttctcgcccatctccgacatcggcctggccaagtcggcggacagcccg
ctgcaggccagctccgccctcagccagaactccctgttcacgttccggcccgccctggag
gagccctctgccgatgccaagctggccgctcaccccaggaaaggctttcccggctccctg
tcgggggctgacggactcagcccgggcaccaaccctgccaacggctgcaccttcggcggg
ggcctggccgcggacctgagtttacacagcttcagtgatggtgcttctcttccccacaag
ggccccgaggcggccggcctgagctccccgctgagcttcccctcgcagcgcggcaaggag
ggctcggacgccaaccctttcctgagcaagaggcagctggacggcctggctgggctgaag
ggcgagggcagccgcggcaaggaggcaggggagggcggcctaccgctgtgcgggcccacg
gacaagaccccactgctgagcggcaaggccgccaaggcccgggaccgcgaggtcgacctc
aagaatggccacaacctcttcatctctgcggcggccgtgcctcccggaagcctcctcagc
ggccccggcctggccccggcggcgtcctccgcaggcggcgcggcgtcctccgcccagacg
caccggtccttcctgggccccttcccgccgggaccgcagttcgcgctcggccccatgtcc
ctgcaggccaacctcggctccgtggccggctcctccgtgctgcagtcgctgttcagctct
gtgccggccgccgcaggcctggtgcacgtgtcgtccgctgccaccagactgaccaactcg
cacgccatgggcagcttttccggggtggcaggcggcacagttggaggtaactag

DBGET integrated database retrieval system