KEGG   Homo sapiens (human): 1026Help
Entry
1026              CDS       T01001                                 

Gene name
CDKN1A, CAP20, CDKN1, CIP1, MDA-6, P21, SDI1, WAF1, p21CIP1
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa01524  Platinum drug resistance
hsa04012  ErbB signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04115  p53 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa04630  Jak-STAT signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05218  Melanoma
hsa05219  Bladder cancer
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06170  Influenza A virus (IAV)
nt06230  Cell cycle G1/S
nt06240  Transcription
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06264  Renal cell carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06267  Small cell lung cancer
nt06268  Melanoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06273  Glioma
nt06274  Thyroid cancer
nt06276  Chronic myeloid leukemia
nt06319  AHR-cell cycle regulation
nt06360  Cushing syndrome
  Element
N00066  MDM2-p21-Cell cycle G1/S
N00067  Deleted p14(ARF) to p21-cell cycle G1/S
N00068  Amplified MDM2 to p21-cell cycle G1/S
N00076  Mutation-inactivated p14(ARF) to p21-cell cycle G1/S
N00115  Mutation-inactivated TP53 to transcription
N00127  PRCC-TFE3 fusion to transcriptional activation
N00134  EWSR1-FLI1 fusion to transcriptional repression
N00167  KSHV vIRF1/3 to p21-cell cycle G1/S
N00169  KSHV LANA to p21-cell cycle G1/S
N00223  EBV EBNA1 to p53-mediated transcription
N00263  EBV EBNA3C to p53-mediated transcription
N00317  Aryl hydrocarbon receptor signaling pathway
N00347  p300-p21-Cell cycle G1/S
N00348  HPV E6 to p300-p21-Cell cycle G1/S
N00349  HPV E6 to p300-p21-Cell cycle G1/S
N00358  HPV E6 to p21-cell cycle G1/S
N00359  HPV E7 to p27-cell cycle G1/S
N00362  HPV E5 to p21-cell cycle G1/S
N00420  HCMV IE2-86 to p21-cell cycle G1/S
N00421  HCMV IE2-86 to p21-cell cycle G1/S
N00481  EBV BZLF1 to p53-mediated transcription
N00496  MDM2-p21-Cell cycle G1/S
N00497  HTLV-1 Tax to p21-cell cycle G1/S
N00498  HTLV-1 Tax to p21-cell cycle G1/S
N00499  ATR-p21-Cell cycle G2/M
N00520  HCV NS5A to p21-cell cycle G1/S
N00521  HCV Core to p21-cell cycle G1/S
N00522  HCV NS3 to p21-cell cycle G1/S
N00523  HCV Core to p21-cell cycle G1/S
N00535  HBV HBx to p53-mediated transcription
N00536  MDM2-p21-Cell cycle G1/S
Disease
H00030  Cervical cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    1026 (CDKN1A)
   04630 Jak-STAT signaling pathway
    1026 (CDKN1A)
   04066 HIF-1 signaling pathway
    1026 (CDKN1A)
   04068 FoxO signaling pathway
    1026 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    1026 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    1026 (CDKN1A)
   04115 p53 signaling pathway
    1026 (CDKN1A)
   04218 Cellular senescence
    1026 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    1026 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    1026 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1026 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    1026 (CDKN1A)
   05206 MicroRNAs in cancer
    1026 (CDKN1A)
   05205 Proteoglycans in cancer
    1026 (CDKN1A)
   05203 Viral carcinogenesis
    1026 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    1026 (CDKN1A)
   05212 Pancreatic cancer
    1026 (CDKN1A)
   05225 Hepatocellular carcinoma
    1026 (CDKN1A)
   05226 Gastric cancer
    1026 (CDKN1A)
   05214 Glioma
    1026 (CDKN1A)
   05216 Thyroid cancer
    1026 (CDKN1A)
   05220 Chronic myeloid leukemia
    1026 (CDKN1A)
   05217 Basal cell carcinoma
    1026 (CDKN1A)
   05218 Melanoma
    1026 (CDKN1A)
   05211 Renal cell carcinoma
    1026 (CDKN1A)
   05219 Bladder cancer
    1026 (CDKN1A)
   05215 Prostate cancer
    1026 (CDKN1A)
   05213 Endometrial cancer
    1026 (CDKN1A)
   05224 Breast cancer
    1026 (CDKN1A)
   05222 Small cell lung cancer
    1026 (CDKN1A)
   05223 Non-small cell lung cancer
    1026 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    1026 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    1026 (CDKN1A)
   05161 Hepatitis B
    1026 (CDKN1A)
   05160 Hepatitis C
    1026 (CDKN1A)
   05163 Human cytomegalovirus infection
    1026 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    1026 (CDKN1A)
   05169 Epstein-Barr virus infection
    1026 (CDKN1A)
   05165 Human papillomavirus infection
    1026 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    1026 (CDKN1A)
   01522 Endocrine resistance
    1026 (CDKN1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDI
Motif
Other DBs
NCBI-GeneID: 1026
NCBI-ProteinID: NP_000380
OMIM: 116899
HGNC: 1784
Ensembl: ENSG00000124762
Vega: OTTHUMG00000014603
Pharos: P38936(Tbio)
UniProt: P38936 A0A024RCX5
LinkDB All DBs
Structure
PDB: 

Position
6p21.2
AA seq 164 aa AA seqDB search
MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV
PRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaccggctggggatgtccgtcagaacccatgcggcagcaaggcctgccgccgc
ctcttcggcccagtggacagcgagcagctgagccgcgactgtgatgcgctaatggcgggc
tgcatccaggaggcccgtgagcgatggaacttcgactttgtcaccgagacaccactggag
ggtgacttcgcctgggagcgtgtgcggggccttggcctgcccaagctctaccttcccacg
gggccccggcgaggccgggatgagttgggaggaggcaggcggcctggcacctcacctgct
ctgctgcaggggacagcagaggaagaccatgtggacctgtcactgtcttgtacccttgtg
cctcgctcaggggagcaggctgaagggtccccaggtggacctggagactctcagggtcga
aaacggcggcagaccagcatgacagatttctaccactccaaacgccggctgatcttctcc
aagaggaagccctaa

KEGG   Homo sapiens (human): 1647Help
Entry
1647              CDS       T01001                                 

Gene name
GADD45A, DDIT1, GADD45
Definition
(RefSeq) growth arrest and DNA damage inducible alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
hsa04218  Cellular senescence
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06165  Epstein-Barr virus (EBV)
nt06240  Transcription
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06267  Small cell lung cancer
nt06268  Melanoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06273  Glioma
nt06274  Thyroid cancer
nt06276  Chronic myeloid leukemia
  Element
N00115  Mutation-inactivated TP53 to transcription
N00223  EBV EBNA1 to p53-mediated transcription
N00263  EBV EBNA3C to p53-mediated transcription
N00481  EBV BZLF1 to p53-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    1647 (GADD45A)
   04068 FoxO signaling pathway
    1647 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    1647 (GADD45A)
   04210 Apoptosis
    1647 (GADD45A)
   04115 p53 signaling pathway
    1647 (GADD45A)
   04218 Cellular senescence
    1647 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1647 (GADD45A)
   05202 Transcriptional misregulation in cancer
    1647 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    1647 (GADD45A)
   05212 Pancreatic cancer
    1647 (GADD45A)
   05225 Hepatocellular carcinoma
    1647 (GADD45A)
   05226 Gastric cancer
    1647 (GADD45A)
   05214 Glioma
    1647 (GADD45A)
   05216 Thyroid cancer
    1647 (GADD45A)
   05220 Chronic myeloid leukemia
    1647 (GADD45A)
   05217 Basal cell carcinoma
    1647 (GADD45A)
   05218 Melanoma
    1647 (GADD45A)
   05213 Endometrial cancer
    1647 (GADD45A)
   05224 Breast cancer
    1647 (GADD45A)
   05222 Small cell lung cancer
    1647 (GADD45A)
   05223 Non-small cell lung cancer
    1647 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    1647 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1647 (GADD45A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     1647 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     1647 (GADD45A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae XPA_C
Motif
Other DBs
NCBI-GeneID: 1647
NCBI-ProteinID: NP_001915
OMIM: 126335
HGNC: 4095
Ensembl: ENSG00000116717
Vega: OTTHUMG00000009374
Pharos: P24522(Tbio)
UniProt: P24522
LinkDB All DBs
Structure
PDB: 

Position
1p31.3
AA seq 165 aa AA seqDB search
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgactttggaggaattctcggctggagagcagaagaccgaaaggatggataaggtgggg
gatgccctggaggaagtgctcagcaaagccctgagtcagcgcacgatcactgtcggggtg
tacgaagcggccaagctgctcaacgtcgaccccgataacgtggtgttgtgcctgctggcg
gcggacgaggacgacgacagagatgtggctctgcagatccacttcaccctgatccaggcg
ttttgctgcgagaacgacatcaacatcctgcgcgtcagcaacccgggccggctggcggag
ctcctgctcttggagaccgacgctggccccgcggcgagcgagggcgccgagcagcccccg
gacctgcactgcgtgctggtgacgaatccacattcatctcaatggaaggatcctgcctta
agtcaacttatttgtttttgccgggaaagtcgctacatggatcaatgggttccagtgatt
aatctccctgaacggtga

KEGG   Homo sapiens (human): 4616Help
Entry
4616              CDS       T01001                                 

Gene name
GADD45B, GADD45BETA, MYD118
Definition
(RefSeq) growth arrest and DNA damage inducible beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
hsa04218  Cellular senescence
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06165  Epstein-Barr virus (EBV)
nt06240  Transcription
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06267  Small cell lung cancer
nt06268  Melanoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06273  Glioma
nt06274  Thyroid cancer
nt06276  Chronic myeloid leukemia
  Element
N00115  Mutation-inactivated TP53 to transcription
N00223  EBV EBNA1 to p53-mediated transcription
N00263  EBV EBNA3C to p53-mediated transcription
N00481  EBV BZLF1 to p53-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4616 (GADD45B)
   04064 NF-kappa B signaling pathway
    4616 (GADD45B)
   04068 FoxO signaling pathway
    4616 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    4616 (GADD45B)
   04210 Apoptosis
    4616 (GADD45B)
   04115 p53 signaling pathway
    4616 (GADD45B)
   04218 Cellular senescence
    4616 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4616 (GADD45B)
   05202 Transcriptional misregulation in cancer
    4616 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    4616 (GADD45B)
   05212 Pancreatic cancer
    4616 (GADD45B)
   05225 Hepatocellular carcinoma
    4616 (GADD45B)
   05226 Gastric cancer
    4616 (GADD45B)
   05214 Glioma
    4616 (GADD45B)
   05216 Thyroid cancer
    4616 (GADD45B)
   05220 Chronic myeloid leukemia
    4616 (GADD45B)
   05217 Basal cell carcinoma
    4616 (GADD45B)
   05218 Melanoma
    4616 (GADD45B)
   05213 Endometrial cancer
    4616 (GADD45B)
   05224 Breast cancer
    4616 (GADD45B)
   05222 Small cell lung cancer
    4616 (GADD45B)
   05223 Non-small cell lung cancer
    4616 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    4616 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    4616 (GADD45B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     4616 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     4616 (GADD45B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae
Motif
Other DBs
NCBI-GeneID: 4616
NCBI-ProteinID: NP_056490
OMIM: 604948
HGNC: 4096
Ensembl: ENSG00000099860
Vega: OTTHUMG00000180434
Pharos: O75293(Tbio)
UniProt: O75293
LinkDB All DBs
Position
19p13.3
AA seq 160 aa AA seqDB search
MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCL
LVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggaagagctcgtggcgtgcgacaacgcggcgcagaagatgcagacggtgacc
gccgcggtggaggagcttttggtggccgctcagcgccaggatcgcctcacagtgggggtg
tacgagtcggccaagttgatgaatgtggacccagacagcgtggtcctctgcctcttggcc
attgacgaggaggaggaggatgacatcgccctgcaaatccacttcacgctcatccagtcc
ttctgctgtgacaacgacatcaacatcgtgcgggtgtcgggcatgcagcgcctggcgcag
ctcctgggagagccggccgagacccagggcaccaccgaggcccgagacctgcattgtctc
ctggtcacgaaccctcacacggacgcctggaagagccacggcttggtggaggtggccagc
tactgcgaagaaagccggggcaacaaccagtgggtcccctacatctctcttcaggaacgc
tga

KEGG   Homo sapiens (human): 10912Help
Entry
10912             CDS       T01001                                 

Gene name
GADD45G, CR6, DDIT2, GADD45gamma, GRP17
Definition
(RefSeq) growth arrest and DNA damage inducible gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
hsa04218  Cellular senescence
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06165  Epstein-Barr virus (EBV)
nt06240  Transcription
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06267  Small cell lung cancer
nt06268  Melanoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06273  Glioma
nt06274  Thyroid cancer
nt06276  Chronic myeloid leukemia
  Element
N00115  Mutation-inactivated TP53 to transcription
N00223  EBV EBNA1 to p53-mediated transcription
N00263  EBV EBNA3C to p53-mediated transcription
N00481  EBV BZLF1 to p53-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    10912 (GADD45G)
   04068 FoxO signaling pathway
    10912 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    10912 (GADD45G)
   04210 Apoptosis
    10912 (GADD45G)
   04115 p53 signaling pathway
    10912 (GADD45G)
   04218 Cellular senescence
    10912 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    10912 (GADD45G)
   05202 Transcriptional misregulation in cancer
    10912 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    10912 (GADD45G)
   05212 Pancreatic cancer
    10912 (GADD45G)
   05225 Hepatocellular carcinoma
    10912 (GADD45G)
   05226 Gastric cancer
    10912 (GADD45G)
   05214 Glioma
    10912 (GADD45G)
   05216 Thyroid cancer
    10912 (GADD45G)
   05220 Chronic myeloid leukemia
    10912 (GADD45G)
   05217 Basal cell carcinoma
    10912 (GADD45G)
   05218 Melanoma
    10912 (GADD45G)
   05213 Endometrial cancer
    10912 (GADD45G)
   05224 Breast cancer
    10912 (GADD45G)
   05222 Small cell lung cancer
    10912 (GADD45G)
   05223 Non-small cell lung cancer
    10912 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    10912 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10912 (GADD45G)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     10912 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     10912 (GADD45G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae
Motif
Other DBs
NCBI-GeneID: 10912
NCBI-ProteinID: NP_006696
OMIM: 604949
HGNC: 4097
Ensembl: ENSG00000130222
Vega: OTTHUMG00000020187
Pharos: O95257(Tbio)
UniProt: O95257
LinkDB All DBs
Structure
PDB: 

Position
9q22.2
AA seq 159 aa AA seqDB search
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgactctggaagaagtccgcggccaggacacagttccggaaagcacagccaggatgcag
ggtgccgggaaagcgctgcatgagttgctgctgtcggcgcagcgtcagggctgcctcact
gccggcgtctacgagtcagccaaagtcttgaacgtggaccccgacaatgtgaccttctgt
gtgctggctgcgggtgaggaggacgagggcgacatcgcgctgcagatccattttacgctg
atccaggctttctgctgcgagaacgacatcgacatagtgcgcgtgggcgatgtgcagcgg
ctggcggctatcgtgggcgccggcgaggaggcgggtgcgccgggcgacctgcactgcatc
ctcatttcgaaccccaacgaggacgcctggaaggatcccgccttggagaagctcagcctg
ttttgcgaggagagccgcagcgttaacgactgggtgcccagcatcaccctccccgagtga

KEGG   Homo sapiens (human): 581Help
Entry
581               CDS       T01001                                 

Gene name
BAX, BCL2L4
Definition
(RefSeq) BCL2 associated X, apoptosis regulator
  KO
K02159  apoptosis regulator BAX
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa01524  Platinum drug resistance
hsa04071  Sphingolipid signaling pathway
hsa04115  p53 signaling pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04211  Longevity regulating pathway
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04722  Neurotrophin signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05016  Huntington disease
hsa05020  Prion diseases
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06131  Apoptosis (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
nt06231  Apoptosis
nt06240  Transcription
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06267  Small cell lung cancer
nt06268  Melanoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06273  Glioma
nt06274  Thyroid cancer
nt06276  Chronic myeloid leukemia
  Element
N00098  Intrinsic apoptotic pathway
N00099  Mutation-inactivated BAX to apoptotic pathway
N00100  BCL2-overexpression to intrinsic apoptotic pathway
N00115  Mutation-inactivated TP53 to transcription
N00146  Crosstalk between extrinsic and intrinsic apoptotic pathways
N00164  KSHV vBCL2 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00223  EBV EBNA1 to p53-mediated transcription
N00262  EBV EBNA3C to intrinsic apoptotic pathway
N00263  EBV EBNA3C to p53-mediated transcription
N00425  HCMV UL36 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00426  HCMV UL37x1 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00449  HIV Tat/Nef to crosstalk between extrinsic and intrinsic apoptotic pathways
N00450  HIV Tat to intrinsic apoptotic pathway
N00451  HIV Tat to intrinsic apoptotic pathway
N00452  HIV Nef to intrinsic apoptotic pathway
N00453  HIV Vpr to intrinsic apoptotic pathway
N00454  HIV Vpr to intrinsic apoptotic pathway
N00474  EBV BHRF1 to intrinsic apoptotic pathway
N00475  EBV BHRF1 to intrinsic apoptotic pathway
N00477  EBV BHRF1 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00478  EBV BARF1 to intrinsic apoptotic pathway
N00481  EBV BZLF1 to p53-mediated transcription
N00511  HTLV-1 Tax to E47-mediated transcription
N00526  HCV NS3 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00527  HCV Core to crosstalk between extrinsic and intrinsic apoptotic pathways
N00534  HBV HBx to Crosstalk between extrinsic and intrinsic apoptotic pathways
N00535  HBV HBx to p53-mediated transcription
N00585  HSV US3 to intrinsic apoptotic pathway
Disease
H00020  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    581 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    581 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    581 (BAX)
   04215 Apoptosis - multiple species
    581 (BAX)
   04217 Necroptosis
    581 (BAX)
   04115 p53 signaling pathway
    581 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    581 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    581 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    581 (BAX)
   05202 Transcriptional misregulation in cancer
    581 (BAX)
   05203 Viral carcinogenesis
    581 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    581 (BAX)
   05212 Pancreatic cancer
    581 (BAX)
   05225 Hepatocellular carcinoma
    581 (BAX)
   05226 Gastric cancer
    581 (BAX)
   05214 Glioma
    581 (BAX)
   05216 Thyroid cancer
    581 (BAX)
   05220 Chronic myeloid leukemia
    581 (BAX)
   05217 Basal cell carcinoma
    581 (BAX)
   05218 Melanoma
    581 (BAX)
   05213 Endometrial cancer
    581 (BAX)
   05224 Breast cancer
    581 (BAX)
   05222 Small cell lung cancer
    581 (BAX)
   05223 Non-small cell lung cancer
    581 (BAX)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    581 (BAX)
   05016 Huntington disease
    581 (BAX)
   05020 Prion diseases
    581 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    581 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    581 (BAX)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    581 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    581 (BAX)
   05170 Human immunodeficiency virus 1 infection
    581 (BAX)
   05162 Measles
    581 (BAX)
   05164 Influenza A
    581 (BAX)
   05161 Hepatitis B
    581 (BAX)
   05160 Hepatitis C
    581 (BAX)
   05168 Herpes simplex virus 1 infection
    581 (BAX)
   05163 Human cytomegalovirus infection
    581 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    581 (BAX)
   05169 Epstein-Barr virus infection
    581 (BAX)
   05165 Human papillomavirus infection
    581 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    581 (BAX)
   01524 Platinum drug resistance
    581 (BAX)
   01522 Endocrine resistance
    581 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    581 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    581 (BAX)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    581 (BAX)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   581 (BAX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2
Motif
Other DBs
NCBI-GeneID: 581
NCBI-ProteinID: NP_620116
OMIM: 600040
HGNC: 959
Ensembl: ENSG00000087088
Vega: OTTHUMG00000160476
Pharos: Q07812(Tchem)
UniProt: Q07812
LinkDB All DBs
Structure
PDB: 

Position
19q13.33
AA seq 192 aa AA seqDB search
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggacgggtccggggagcagcccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatggggggg
gaggcacccgagctggccctggacccggtgcctcaggatgcgtccaccaagaagctgagc
gagtgtctcaagcgcatcggggacgaactggacagtaacatggagctgcagaggatgatt
gccgccgtggacacagactccccccgagaggtctttttccgagtggcagctgacatgttt
tctgacggcaacttcaactggggccgggttgtcgcccttttctactttgccagcaaactg
gtgctcaaggccctgtgcaccaaggtgccggaactgatcagaaccatcatgggctggaca
ttggacttcctccgggagcggctgttgggctggatccaagaccagggtggttgggacggc
ctcctctcctactttgggacgcccacgtggcagaccgtgaccatctttgtggcgggagtg
ctcaccgcctcactcaccatctggaagaagatgggctga

KEGG   Homo sapiens (human): 578Help
Entry
578               CDS       T01001                                 

Gene name
BAK1, BAK, BAK-LIKE, BCL2L7, CDN1
Definition
(RefSeq) BCL2 antagonist/killer 1
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa05160  Hepatitis C
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06131  Apoptosis (virus)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
nt06231  Apoptosis
nt06240  Transcription
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06267  Small cell lung cancer
nt06268  Melanoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06273  Glioma
nt06274  Thyroid cancer
nt06276  Chronic myeloid leukemia
  Element
N00098  Intrinsic apoptotic pathway
N00115  Mutation-inactivated TP53 to transcription
N00146  Crosstalk between extrinsic and intrinsic apoptotic pathways
N00164  KSHV vBCL2 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00223  EBV EBNA1 to p53-mediated transcription
N00262  EBV EBNA3C to intrinsic apoptotic pathway
N00263  EBV EBNA3C to p53-mediated transcription
N00383  HPV E6 to intrinsic apoptotic pathway
N00425  HCMV UL36 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00449  HIV Tat/Nef to crosstalk between extrinsic and intrinsic apoptotic pathways
N00451  HIV Tat to intrinsic apoptotic pathway
N00452  HIV Nef to intrinsic apoptotic pathway
N00453  HIV Vpr to intrinsic apoptotic pathway
N00474  EBV BHRF1 to intrinsic apoptotic pathway
N00475  EBV BHRF1 to intrinsic apoptotic pathway
N00476  EBV BHRF1 to intrinsic apoptotic pathway
N00477  EBV BHRF1 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00478  EBV BARF1 to intrinsic apoptotic pathway
N00481  EBV BZLF1 to p53-mediated transcription
N00526  HCV NS3 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00527  HCV Core to crosstalk between extrinsic and intrinsic apoptotic pathways
N00585  HSV US3 to intrinsic apoptotic pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    578 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    578 (BAK1)
   04215 Apoptosis - multiple species
    578 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    578 (BAK1)
   05202 Transcriptional misregulation in cancer
    578 (BAK1)
   05206 MicroRNAs in cancer
    578 (BAK1)
   05203 Viral carcinogenesis
    578 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    578 (BAK1)
   05212 Pancreatic cancer
    578 (BAK1)
   05225 Hepatocellular carcinoma
    578 (BAK1)
   05226 Gastric cancer
    578 (BAK1)
   05214 Glioma
    578 (BAK1)
   05216 Thyroid cancer
    578 (BAK1)
   05220 Chronic myeloid leukemia
    578 (BAK1)
   05217 Basal cell carcinoma
    578 (BAK1)
   05218 Melanoma
    578 (BAK1)
   05213 Endometrial cancer
    578 (BAK1)
   05224 Breast cancer
    578 (BAK1)
   05222 Small cell lung cancer
    578 (BAK1)
   05223 Non-small cell lung cancer
    578 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    578 (BAK1)
   05162 Measles
    578 (BAK1)
   05164 Influenza A
    578 (BAK1)
   05160 Hepatitis C
    578 (BAK1)
   05168 Herpes simplex virus 1 infection
    578 (BAK1)
   05163 Human cytomegalovirus infection
    578 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    578 (BAK1)
   05169 Epstein-Barr virus infection
    578 (BAK1)
   05165 Human papillomavirus infection
    578 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    578 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    578 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    578 (BAK1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    578 (BAK1)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   578 (BAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 Bcl-2_3
Motif
Other DBs
NCBI-GeneID: 578
NCBI-ProteinID: NP_001179
OMIM: 600516
HGNC: 949
Ensembl: ENSG00000030110
Vega: OTTHUMG00000014530
Pharos: Q16611(Tbio)
UniProt: Q16611 A0A0S2Z391
LinkDB All DBs
Structure
PDB: 

Position
6p21.31
AA seq 211 aa AA seqDB search
MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEM
VTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFE
SGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAA
LNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggggcaaggcccaggtcctcccaggcaggagtgcggagagcctgccctgccc
tctgcttctgaggagcaggtagcccaggacacagaggaggttttccgcagctacgttttt
taccgccatcagcaggaacaggaggctgaaggggtggctgcccctgccgacccagagatg
gtcaccttacctctgcaacctagcagcaccatggggcaggtgggacggcagctcgccatc
atcggggacgacatcaaccgacgctatgactcagagttccagaccatgttgcagcacctg
cagcccacggcagagaatgcctatgagtacttcaccaagattgccaccagcctgtttgag
agtggcatcaattggggccgtgtggtggctcttctgggcttcggctaccgtctggcccta
cacgtctaccagcatggcctgactggcttcctaggccaggtgacccgcttcgtggtcgac
ttcatgctgcatcactgcattgcccggtggattgcacagaggggtggctgggtggcagcc
ctgaacttgggcaatggtcccatcctgaacgtgctggtggttctgggtgtggttctgttg
ggccagtttgtggtacgaagattcttcaaatcatga

KEGG   Homo sapiens (human): 1643Help
Entry
1643              CDS       T01001                                 

Gene name
DDB2, DDBB, UV-DDB2, XPE
Definition
(RefSeq) damage specific DNA binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03420  Nucleotide excision repair
hsa04115  p53 signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa05161  Hepatitis B
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06165  Epstein-Barr virus (EBV)
nt06240  Transcription
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06267  Small cell lung cancer
nt06268  Melanoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06273  Glioma
nt06274  Thyroid cancer
nt06276  Chronic myeloid leukemia
  Element
N00115  Mutation-inactivated TP53 to transcription
N00223  EBV EBNA1 to p53-mediated transcription
N00263  EBV EBNA3C to p53-mediated transcription
N00481  EBV BZLF1 to p53-mediated transcription
Disease
H00403  Disorders of nucleotide excision repair
H01428  Xeroderma pigmentosum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    1643 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    1643 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    1643 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1643 (DDB2)
   05202 Transcriptional misregulation in cancer
    1643 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    1643 (DDB2)
   05212 Pancreatic cancer
    1643 (DDB2)
   05225 Hepatocellular carcinoma
    1643 (DDB2)
   05226 Gastric cancer
    1643 (DDB2)
   05214 Glioma
    1643 (DDB2)
   05216 Thyroid cancer
    1643 (DDB2)
   05220 Chronic myeloid leukemia
    1643 (DDB2)
   05217 Basal cell carcinoma
    1643 (DDB2)
   05218 Melanoma
    1643 (DDB2)
   05213 Endometrial cancer
    1643 (DDB2)
   05224 Breast cancer
    1643 (DDB2)
   05222 Small cell lung cancer
    1643 (DDB2)
   05223 Non-small cell lung cancer
    1643 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    1643 (DDB2)
   05169 Epstein-Barr virus infection
    1643 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    1643 (DDB2)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    1643 (DDB2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     1643 (DDB2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      1643 (DDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 1643
NCBI-ProteinID: NP_000098
OMIM: 600811
HGNC: 2718
Ensembl: ENSG00000134574
Vega: OTTHUMG00000187453
Pharos: Q92466(Tbio)
UniProt: Q92466
LinkDB All DBs
Structure
PDB: 

Position
11p11.2
AA seq 427 aa AA seqDB search
MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGP
QILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWH
PTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGT
TRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRM
HKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDG
ARLLTTDQKSEIRVYSASQWDCPLGLIPHPHRHFQHLTPIKAAWHPRYNLIVVGRYPDPN
FKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHILIWSQ
EEARTRK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaagaaacgcccagaaacccagaagacctccgagattgtattacgccccagg
aacaagaggagcaggagtcccctggagctggagcccgaggccaagaagctctgtgcgaag
ggctccggtcctagcagaagatgtgactcagactgcctctgggtggggctggctggccca
cagatcctgccaccatgccgcagcatcgtcaggaccctccaccagcataagctgggcaga
gcttcctggccatctgtccagcaggggctccagcagtcctttttgcacactctggattct
taccggatattacaaaaggctgccccctttgacaggagggctacatccttggcgtggcac
ccaactcaccccagcaccgtggctgtgggttccaaagggggagatatcatgctctggaat
tttggcatcaaggacaaacccaccttcatcaaagggattggagctggagggagcatcact
gggctgaagtttaaccctctcaataccaaccagttttacgcctcctcaatggagggaaca
actaggctgcaagactttaaaggcaacattctacgagtttttgccagctcagacaccatc
aacatctggttttgtagcctggatgtgtctgctagtagccgaatggtggtcacaggagac
aacgtggggaacgtgatcctgctgaacatggacggcaaagagctttggaatctcagaatg
cacaaaaagaaagtgacgcatgtggccctgaacccatgctgtgattggttcctggccaca
gcctccgtagatcaaacagtgaaaatttgggacctgcgccaggttagagggaaagccagc
ttcctctactcgctgccgcacaggcatcctgtcaacgcagcttgtttcagtcccgatgga
gcccggctcctgaccacggaccagaagagcgagatccgagtttactctgcttcccagtgg
gactgccccctgggcctgatcccgcaccctcaccgtcacttccagcacctcacacccatc
aaggcagcctggcatcctcgctacaacctcattgttgtgggccgatacccagatcctaat
ttcaaaagttgtaccccttatgaattgaggacgatcgacgtgttcgatggaaactcaggg
aagatgatgtgtcagctctatgacccagaatcttctggcatcagttcgcttaatgaattc
aatcccatgggggacacgctggcctctgcaatgggttaccacattctcatctggagccag
gaggaagccaggacacggaagtga

KEGG   Homo sapiens (human): 51426Help
Entry
51426             CDS       T01001                                 

Gene name
POLK, DINB1, DINP, POLQ
Definition
(RefSeq) DNA polymerase kappa
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06165  Epstein-Barr virus (EBV)
nt06240  Transcription
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06267  Small cell lung cancer
nt06268  Melanoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06273  Glioma
nt06274  Thyroid cancer
nt06276  Chronic myeloid leukemia
  Element
N00115  Mutation-inactivated TP53 to transcription
N00223  EBV EBNA1 to p53-mediated transcription
N00263  EBV EBNA3C to p53-mediated transcription
N00481  EBV BZLF1 to p53-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    51426 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    51426 (POLK)
   05202 Transcriptional misregulation in cancer
    51426 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    51426 (POLK)
   05212 Pancreatic cancer
    51426 (POLK)
   05225 Hepatocellular carcinoma
    51426 (POLK)
   05226 Gastric cancer
    51426 (POLK)
   05214 Glioma
    51426 (POLK)
   05216 Thyroid cancer
    51426 (POLK)
   05220 Chronic myeloid leukemia
    51426 (POLK)
   05217 Basal cell carcinoma
    51426 (POLK)
   05218 Melanoma
    51426 (POLK)
   05213 Endometrial cancer
    51426 (POLK)
   05224 Breast cancer
    51426 (POLK)
   05222 Small cell lung cancer
    51426 (POLK)
   05223 Non-small cell lung cancer
    51426 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    51426 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    51426 (POLK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     51426 (POLK)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    51426 (POLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone zf-C2H2_12
Motif
Other DBs
NCBI-GeneID: 51426
NCBI-ProteinID: NP_057302
OMIM: 605650
HGNC: 9183
Ensembl: ENSG00000122008
Vega: OTTHUMG00000102107
Pharos: Q9UBT6(Tbio)
UniProt: Q9UBT6 A0A024RAP4
LinkDB All DBs
Structure
PDB: 

Position
5q13.3
AA seq 870 aa AA seqDB search
MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQV
NQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDN
PELKDKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKE
VKEILADYDPNFMAMSLDEAYLNITKHLEERQNWPEDKRRYFIKMGSSVENDNPGKEVNK
LSEHERSISPLLFEESPSDVQPPGDPFQVNFEEQNNPQILQNSVVFGTSAQEVVKEIRFR
IEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKV
TEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVER
TFSEINKAEEQYSLCQELCSELAQDLQKERLKGRTVTIKLKNVNFEVKTRASTVSSVVST
AEEIFAIAKELLKTEIDADFPHPLRLRLMGVRISSFPNEEDRKHQQRSIIGFLQAGNQAL
SATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQSFQTSQPFQ
VLKKKMNENLEISENSDDCQILTCPVCFRAQGCISLEALNKHVDECLDGPSISENFKMFS
CSHVSATKVNKKENVPASSLCEKQDYEAHPKIKEISSVDCIALVDTIDNSSKAESIDALS
NKHSKEECSSLPSKSFNIEHCHQNSSSTVSLENEDVGSFRQEYRQPYLCEVKTGQALVCP
VCNVEQKTSDLTLFNVHVDVCLNKSFIQELRKDKFNPVNQPKESSRSTGSSSGVQKAVTR
TKRPGLMTKYSTSKKIKPNNPKHTLDIFFK
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atggatagcacaaaggagaagtgtgacagttacaaagatgatcttctgcttaggatggga
cttaatgataataaagcaggaatggaaggattagataaagagaaaattaacaaaattata
atggaagccacgaaggggtccagattttatggaaatgagctcaagaaagaaaagcaagtc
aaccaacgaattgaaaatatgatgcaacaaaaagctcaaatcaccagccaacagctaaga
aaagcacaattacaggttgacagatttgcaatggaattagaacaaagccgaaatttgagc
aataccatagtgcacattgacatggatgctttctatgcagctgtagaaatgagggacaat
ccagaattgaaggataaacccattgctgtaggatcaatgagtatgctgtctacttcaaat
taccatgcaaggagatttggtgttcgtgcagccatgccaggatttattgctaagaggctg
tgcccacaacttataatagtgccccccaactttgacaaataccgagctgtgagtaaagag
gttaaggaaatacttgctgattatgatcccaattttatggccatgagtcttgatgaagcc
tacttgaatataacaaagcacttagaagaaagacaaaattggcctgaggataaaagaagg
tatttcatcaaaatgggaagctctgtagaaaatgataatccaggaaaggaagttaataaa
ctgagtgagcatgaacgatccatctctccactactttttgaagagagtccttctgatgtg
cagcccccaggagatcctttccaagtgaactttgaagaacaaaacaatcctcaaatactc
caaaactcagttgtttttggaacatcagcccaggaagtggtaaaggaaattcgtttcaga
attgagcagaaaacaacactgacagccagtgcaggcattgccccaaatacaatgttagca
aaagtatgcagtgataagaataaaccaaatggacaataccaaattcttcccaatagacaa
gctgtgatggacttcatcaaggatttacccattagaaaggtttctggaataggaaaagtt
acagagaaaatgttaaaggcccttggaattattacatgtacagaactttaccaacagagg
gcattgctttctctccttttctctgaaacatcttggcattatttccttcatatctccttg
ggtctaggttcaacacacctgacgagggatggagagaggaaaagtatgagcgttgagagg
acattcagtgagataaataaagcggaagagcaatacagcctatgtcaagaactttgcagt
gagcttgctcaggatctacagaaagaaagacttaagggtagaactgttaccattaagttg
aagaatgtgaattttgaagtaaaaactcgtgcatctacagtttcatctgttgtttctact
gcagaagaaatatttgccattgctaaggaattgctaaaaacagaaattgatgctgatttt
ccacatcccttgagattaaggcttatgggtgttcggatatctagttttcccaatgaagag
gacaggaaacaccaacaaaggagcattattggctttttacaggctggaaaccaagccctg
tcagccactgagtgtacattagagaaaactgacaaagataagtttgtaaaacctctagaa
atgtctcataagaagagtttctttgataaaaaacgatcagaaaggaaatggagtcaccaa
gatacatttaaatgtgaagccgtgaataaacaaagtttccagacatcacaaccattccaa
gttttaaagaagaagatgaatgagaatttggaaatatcagagaattcagatgactgtcag
atacttacctgtcctgtttgctttagggctcaagggtgcatcagtctggaagccttgaat
aaacatgtagatgaatgtcttgatggaccttcaatcagtgaaaactttaaaatgttctcg
tgttcacatgtttctgctaccaaagttaacaagaaagaaaatgttcctgcttcttcactt
tgtgagaagcaagattatgaagcccatccaaaaattaaagaaatatcttcagtagattgt
atagctttagtagatactatagataactcatctaaagcagaaagcatagatgctttaagt
aataagcatagcaaggaagaatgttctagtctcccaagcaagtcttttaatattgaacac
tgtcatcagaattcttcttctactgtttcattggaaaacgaagatgttggatcatttaga
caagaataccgccagccttacttatgtgaagtgaaaacaggccaagctctagtttgtcct
gtttgtaacgtagaacaaaagacttcagatctaaccctgttcaatgtgcatgtggatgtt
tgcttaaataaaagttttatccaagaattaagaaaggataaatttaacccagttaatcaa
cccaaagaaagctccagaagtactggtagctcaagtggagtacagaaggctgtaacaaga
acaaaaaggccaggattgatgacaaagtactcaacatcaaagaaaataaaaccaaacaat
cccaaacatacccttgatatattttttaagtaa

DBGET integrated database retrieval system