KEGG   Homo sapiens (human): 1026Help
Entry
1026              CDS       T01001                                 

Gene name
CDKN1A, CAP20, CDKN1, CIP1, MDA-6, P21, SDI1, WAF1, p21CIP1
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa01524  Platinum drug resistance
hsa04012  ErbB signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04115  p53 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa04630  Jak-STAT signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05218  Melanoma
hsa05219  Bladder cancer
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06170  Influenza A virus (IAV)
nt06230  Cell cycle G1/S
nt06240  Transcription
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06264  Renal cell carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06267  Small cell lung cancer
nt06268  Melanoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06273  Glioma
nt06274  Thyroid cancer
nt06276  Chronic myeloid leukemia
nt06319  AHR-cell cycle regulation
nt06360  Cushing syndrome
  Element
N00066  MDM2-p21-Cell cycle G1/S
N00067  Deleted p14(ARF) to p21-cell cycle G1/S
N00068  Amplified MDM2 to p21-cell cycle G1/S
N00076  Mutation-inactivated p14(ARF) to p21-cell cycle G1/S
N00115  Mutation-inactivated TP53 to transcription
N00127  PRCC-TFE3 fusion to transcriptional activation
N00134  EWSR1-FLI1 fusion to transcriptional repression
N00167  KSHV vIRF1/3 to p21-cell cycle G1/S
N00169  KSHV LANA to p21-cell cycle G1/S
N00223  EBV EBNA1 to p53-mediated transcription
N00263  EBV EBNA3C to p53-mediated transcription
N00317  Aryl hydrocarbon receptor signaling pathway
N00347  p300-p21-Cell cycle G1/S
N00348  HPV E6 to p300-p21-Cell cycle G1/S
N00349  HPV E6 to p300-p21-Cell cycle G1/S
N00358  HPV E6 to p21-cell cycle G1/S
N00359  HPV E7 to p27-cell cycle G1/S
N00362  HPV E5 to p21-cell cycle G1/S
N00420  HCMV IE2-86 to p21-cell cycle G1/S
N00421  HCMV IE2-86 to p21-cell cycle G1/S
N00481  EBV BZLF1 to p53-mediated transcription
N00496  MDM2-p21-Cell cycle G1/S
N00497  HTLV-1 Tax to p21-cell cycle G1/S
N00498  HTLV-1 Tax to p21-cell cycle G1/S
N00499  ATR-p21-Cell cycle G2/M
N00520  HCV NS5A to p21-cell cycle G1/S
N00521  HCV Core to p21-cell cycle G1/S
N00522  HCV NS3 to p21-cell cycle G1/S
N00523  HCV Core to p21-cell cycle G1/S
N00535  HBV HBx to p53-mediated transcription
N00536  MDM2-p21-Cell cycle G1/S
Disease
H00030  Cervical cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    1026 (CDKN1A)
   04630 Jak-STAT signaling pathway
    1026 (CDKN1A)
   04066 HIF-1 signaling pathway
    1026 (CDKN1A)
   04068 FoxO signaling pathway
    1026 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    1026 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    1026 (CDKN1A)
   04115 p53 signaling pathway
    1026 (CDKN1A)
   04218 Cellular senescence
    1026 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    1026 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    1026 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1026 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    1026 (CDKN1A)
   05206 MicroRNAs in cancer
    1026 (CDKN1A)
   05205 Proteoglycans in cancer
    1026 (CDKN1A)
   05203 Viral carcinogenesis
    1026 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    1026 (CDKN1A)
   05212 Pancreatic cancer
    1026 (CDKN1A)
   05225 Hepatocellular carcinoma
    1026 (CDKN1A)
   05226 Gastric cancer
    1026 (CDKN1A)
   05214 Glioma
    1026 (CDKN1A)
   05216 Thyroid cancer
    1026 (CDKN1A)
   05220 Chronic myeloid leukemia
    1026 (CDKN1A)
   05217 Basal cell carcinoma
    1026 (CDKN1A)
   05218 Melanoma
    1026 (CDKN1A)
   05211 Renal cell carcinoma
    1026 (CDKN1A)
   05219 Bladder cancer
    1026 (CDKN1A)
   05215 Prostate cancer
    1026 (CDKN1A)
   05213 Endometrial cancer
    1026 (CDKN1A)
   05224 Breast cancer
    1026 (CDKN1A)
   05222 Small cell lung cancer
    1026 (CDKN1A)
   05223 Non-small cell lung cancer
    1026 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    1026 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    1026 (CDKN1A)
   05161 Hepatitis B
    1026 (CDKN1A)
   05160 Hepatitis C
    1026 (CDKN1A)
   05163 Human cytomegalovirus infection
    1026 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    1026 (CDKN1A)
   05169 Epstein-Barr virus infection
    1026 (CDKN1A)
   05165 Human papillomavirus infection
    1026 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    1026 (CDKN1A)
   01522 Endocrine resistance
    1026 (CDKN1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDI
Motif
Other DBs
NCBI-GeneID: 1026
NCBI-ProteinID: NP_000380
OMIM: 116899
HGNC: 1784
Ensembl: ENSG00000124762
Vega: OTTHUMG00000014603
Pharos: P38936(Tbio)
UniProt: P38936 A0A024RCX5
LinkDB All DBs
Structure
PDB: 

Position
6p21.2
AA seq 164 aa AA seqDB search
MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV
PRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaccggctggggatgtccgtcagaacccatgcggcagcaaggcctgccgccgc
ctcttcggcccagtggacagcgagcagctgagccgcgactgtgatgcgctaatggcgggc
tgcatccaggaggcccgtgagcgatggaacttcgactttgtcaccgagacaccactggag
ggtgacttcgcctgggagcgtgtgcggggccttggcctgcccaagctctaccttcccacg
gggccccggcgaggccgggatgagttgggaggaggcaggcggcctggcacctcacctgct
ctgctgcaggggacagcagaggaagaccatgtggacctgtcactgtcttgtacccttgtg
cctcgctcaggggagcaggctgaagggtccccaggtggacctggagactctcagggtcga
aaacggcggcagaccagcatgacagatttctaccactccaaacgccggctgatcttctcc
aagaggaagccctaa

KEGG   Homo sapiens (human): 7048Help
Entry
7048              CDS       T01001                                 

Gene name
TGFBR2, AAT3, FAA3, LDS1B, LDS2, LDS2B, MFS2, RIIC, TAAD2, TBR-ii, TBRII, TGFR-2, TGFbeta-RII
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04068  FoxO signaling pathway
hsa04144  Endocytosis
hsa04218  Cellular senescence
hsa04350  TGF-beta signaling pathway
hsa04380  Osteoclast differentiation
hsa04390  Hippo signaling pathway
hsa04520  Adherens junction
hsa04659  Th17 cell differentiation
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05142  Chagas disease (American trypanosomiasis)
hsa05161  Hepatitis B
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05220  Chronic myeloid leukemia
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06118  TGFB signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06218  TGFB signaling
nt06240  Transcription
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06276  Chronic myeloid leukemia
  Element
N00063  TGF-beta signaling pathway
N00064  Mutation-inactivated TGFBR2 to TGF-beta signaling pathway
N00065  Mutation-inactivated SMAD2 to TGF-beta signaling pathway
N00134  EWSR1-FLI1 fusion to transcriptional repression
N00241  TGFBR2-reduced expression to TGF-beta signaling pathway
N00256  TGFBR1-reduced expression to TGF-beta signaling pathway
N00531  HBV HBx to TGF-beta signaling pathway
Disease
H00020  Colorectal cancer
H00048  Hepatocellular carcinoma
H00800  Loeys-Dietz syndrome
H00801  Familial thoracic aortic aneurysm and dissection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7048 (TGFBR2)
   04350 TGF-beta signaling pathway
    7048 (TGFBR2)
   04390 Hippo signaling pathway
    7048 (TGFBR2)
   04068 FoxO signaling pathway
    7048 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7048 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    7048 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    7048 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    7048 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    7048 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    7048 (TGFBR2)
  09158 Development
   04380 Osteoclast differentiation
    7048 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7048 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    7048 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    7048 (TGFBR2)
   05212 Pancreatic cancer
    7048 (TGFBR2)
   05225 Hepatocellular carcinoma
    7048 (TGFBR2)
   05226 Gastric cancer
    7048 (TGFBR2)
   05220 Chronic myeloid leukemia
    7048 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    7048 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    7048 (TGFBR2)
   05161 Hepatitis B
    7048 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    7048 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    7048 (TGFBR2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     7048 (TGFBR2)
Protein kinases [BR:hsa01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   7048 (TGFBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ecTbetaR2 Pkinase_Tyr Pkinase Haspin_kinase Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 7048
NCBI-ProteinID: NP_003233
OMIM: 190182
HGNC: 11773
Ensembl: ENSG00000163513
Vega: OTTHUMG00000130569
Pharos: P37173(Tchem)
UniProt: P37173 A3QNQ0
LinkDB All DBs
Structure
PDB: 

Position
3p24.1
AA seq 567 aa AA seqDB search
MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFST
CDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPK
CIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAI
SVIIIFYCYRVNRQQKLSSTWETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAH
LHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgggggctgctcaggggcctgtggccgctgcacatcgtcctgtggacgcgtatc
gccagcacgatcccaccgcacgttcagaagtcggttaataacgacatgatagtcactgac
aacaacggtgcagtcaagtttccacaactgtgtaaattttgtgatgtgagattttccacc
tgtgacaaccagaaatcctgcatgagcaactgcagcatcacctccatctgtgagaagcca
caggaagtctgtgtggctgtatggagaaagaatgacgagaacataacactagagacagtt
tgccatgaccccaagctcccctaccatgactttattctggaagatgctgcttctccaaag
tgcattatgaaggaaaaaaaaaagcctggtgagactttcttcatgtgttcctgtagctct
gatgagtgcaatgacaacatcatcttctcagaagaatataacaccagcaatcctgacttg
ttgctagtcatatttcaagtgacaggcatcagcctcctgccaccactgggagttgccata
tctgtcatcatcatcttctactgctaccgcgttaaccggcagcagaagctgagttcaacc
tgggaaaccggcaagacgcggaagctcatggagttcagcgagcactgtgccatcatcctg
gaagatgaccgctctgacatcagctccacgtgtgccaacaacatcaaccacaacacagag
ctgctgcccattgagctggacaccctggtggggaaaggtcgctttgctgaggtctataag
gccaagctgaagcagaacacttcagagcagtttgagacagtggcagtcaagatctttccc
tatgaggagtatgcctcttggaagacagagaaggacatcttctcagacatcaatctgaag
catgagaacatactccagttcctgacggctgaggagcggaagacggagttggggaaacaa
tactggctgatcaccgccttccacgccaagggcaacctacaggagtacctgacgcggcat
gtcatcagctgggaggacctgcgcaagctgggcagctccctcgcccgggggattgctcac
ctccacagtgatcacactccatgtgggaggcccaagatgcccatcgtgcacagggacctc
aagagctccaatatcctcgtgaagaacgacctaacctgctgcctgtgtgactttgggctt
tccctgcgtctggaccctactctgtctgtggatgacctggctaacagtgggcaggtggga
actgcaagatacatggctccagaagtcctagaatccaggatgaatttggagaatgttgag
tccttcaagcagaccgatgtctactccatggctctggtgctctgggaaatgacatctcgc
tgtaatgcagtgggagaagtaaaagattatgagcctccatttggttccaaggtgcgggag
cacccctgtgtcgaaagcatgaaggacaacgtgttgagagatcgagggcgaccagaaatt
cccagcttctggctcaaccaccagggcatccagatggtgtgtgagacgttgactgagtgc
tgggaccacgacccagaggcccgtctcacagcccagtgtgtggcagaacgcttcagtgag
ctggagcatctggacaggctctcggggaggagctgctcggaggagaagattcctgaagac
ggctccctaaacactaccaaatag

KEGG   Homo sapiens (human): 3486Help
Entry
3486              CDS       T01001                                 

Gene name
IGFBP3, BP-53, IBP3
Definition
(RefSeq) insulin like growth factor binding protein 3
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
hsa04218  Cellular senescence
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00134  EWSR1-FLI1 fusion to transcriptional repression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    3486 (IGFBP3)
   04218 Cellular senescence
    3486 (IGFBP3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    3486 (IGFBP3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3486 (IGFBP3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   3486 (IGFBP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thyroglobulin_1 IGFBP
Motif
Other DBs
NCBI-GeneID: 3486
NCBI-ProteinID: NP_000589
OMIM: 146732
HGNC: 5472
Ensembl: ENSG00000146674
Vega: OTTHUMG00000023769
Pharos: P17936(Tchem)
UniProt: P17936 B3KPF0
LinkDB All DBs
Position
7p12.3
AA seq 291 aa AA seqDB search
MQRARPTLWAAALTLLVLLRGPPVARAGASSAGLGPVVRCEPCDARALAQCAPPPAVCAE
LVREPGCGCCLTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAV
SRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHA
KDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNC
DKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgggcgcgacccacgctctgggccgctgcgctgactctgctggtgctgctccgc
gggccgccggtggcgcgggctggcgcgagctcggcgggcttgggtcccgtggtgcgctgc
gagccgtgcgacgcgcgtgcactggcccagtgcgcgcctccgcccgccgtgtgcgcggag
ctggtgcgcgagccgggctgcggctgctgcctgacgtgcgcactgagcgagggccagccg
tgcggcatctacaccgagcgctgtggctccggccttcgctgccagccgtcgcccgacgag
gcgcgaccgctgcaggcgctgctggacggccgcgggctctgcgtcaacgctagtgccgtc
agccgcctgcgcgcctacctgctgccagcgccgccagctccaggaaatgctagtgagtcg
gaggaagaccgcagcgccggcagtgtggagagcccgtccgtctccagcacgcaccgggtg
tctgatcccaagttccaccccctccattcaaagataatcatcatcaagaaagggcatgct
aaagacagccagcgctacaaagttgactacgagtctcagagcacagatacccagaacttc
tcctccgagtccaagcgggagacagaatatggtccctgccgtagagaaatggaagacaca
ctgaatcacctgaagttcctcaatgtgctgagtcccaggggtgtacacattcccaactgt
gacaagaagggattttataagaaaaagcagtgtcgcccttccaaaggcaggaagcggggc
ttctgctggtgtgtggataagtatgggcagcctctcccaggctacaccaccaaggggaag
gaggacgtgcactgctacagcatgcagagcaagtag

DBGET integrated database retrieval system