KEGG   Homo sapiens (human): 102724428
Entry
102724428         CDS       T01001                                 

Gene name
SIK1B, SIK, SIK-1, SIK1, SNF1LK
Definition
(RefSeq) salt inducible kinase 1B (putative)
  KO
K19008  serine/threonine-protein kinase SIK1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102724428 (SIK1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    102724428 (SIK1B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102724428 (SIK1B)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   102724428 (SIK1B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo
Other DBs
NCBI-GeneID: 102724428
NCBI-ProteinID: NP_001307572
HGNC: 52389
Ensembl: ENSG00000275993
Vega: OTTHUMG00000189394
UniProt: A0A0B4J2F2 P57059
LinkDB
Position
21p12
AA seq 783 aa
MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTKTQVAIKIIDK
TRLDSSNLEKIYREVQLMKLLNHPHIIKLYQVMETKDMLYIVTEFAKNGEMFDYLTSNGH
LSENEARKKFWQILSAVEYCHDHHIVHRDLKTENLLLDGNMDIKLADFGFGNFYKSGEPL
STWCGSPPYAAPEVFEGKEYEGPQLDIWSLGVVLYVLVCGSLPFDGPNLPTLRQRVLEGR
FRIPFFMSQDCESLIRRMLVVDPARRITIAQIRQHRWMRAEPCLPGPACPAFSAHSYTSN
LGDYDEQALGIMQTLGVDRQRTVESLQNSSYNHFAAIYYLLLERLKEYRNAQCARPGPAR
QPRPRSSDLSGLEVPQEGLSTDPFRPALLCPQPQTLVQSVLQAEMDCELQSSLQWPLFFP
VDASCSGVFRPRPVSPSSLLDTAISEEARQGPGLEEEQDTQESLPSSTGRRHTLAEVSTR
LSPLTAPCIVVSPSTTASPAEGTSSDSCLTFSASKSPAGLSGTPATQGLLGACSPVRLAS
PFLGSQSATPVLQAQGGLGGAVLLPVSFQEGRRASDTSLTQGLKAFRQQLRKTTRTKGFL
GLNKIKGLARQVCQVPASRASRGGLSPFHAPAQSPGLHGGAAGSREGWSLLEEVLEQQRL
LQLQHHPAAAPGCSQAPQPAPAPFVIAPCDGPGAAPLPSTLLTSGLPLLPPPLLQTGASP
VASAAQLLDTHLHIGTGPTALPAVPPPRLARLAPGCEPLGLLQGDCEMEDLMPCSLGTFV
LVQ
NT seq 2352 nt   +upstreamnt  +downstreamnt
atggttatcatgtcggagttcagcgcggaccccgcgggccagggtcagggccagcagaag
cccctccgggtgggtttttacgacatcgagcggaccctgggcaaaggcaacttcgcggtg
gtgaagctggcgcggcatcgagtcaccaaaacgcaggttgcaataaaaataattgataaa
acacgattagattcaagcaatttggagaaaatctatcgtgaggttcagctgatgaagctt
ctgaaccatccacacatcataaagctttaccaggttatggaaacaaaggacatgctttac
atcgtcactgaatttgctaaaaatggagaaatgtttgattatttgacttccaacgggcac
ctgagtgagaacgaggcgcggaagaagttctggcaaatcctgtcggccgtggagtactgt
cacgaccatcacatcgtccaccgggacctcaagaccgagaacctcctgctggatggcaac
atggacatcaagctggcagattttggatttgggaatttctacaagtcaggagagcctctg
tccacgtggtgtgggagccccccgtatgccgccccggaagtctttgaggggaaggagtat
gaaggcccccagctggacatctggagcctgggcgtggtgctgtacgtcctggtctgcggt
tctctccccttcgatgggcctaacctgccgacgctgagacagcgggtgctggagggccgc
ttccgcatccccttcttcatgtctcaagactgtgagagcctgatccgccgcatgctggtg
gtggaccccgccaggcgcatcaccatcgcccagatccggcagcaccggtggatgcgggct
gagccctgcttgccgggacccgcctgccccgccttctccgcacacagctacacctccaac
ctgggcgactacgatgagcaggcgctgggtatcatgcagaccctgggcgtggaccggcag
aggacggtggagtcactgcaaaacagcagctataaccactttgctgccatttattacctc
ctccttgagcggctcaaggagtatcggaatgcccagtgcgcccgccccgggcctgccagg
cagccgcggcctcggagctcggacctcagtggtttggaggtgcctcaggaaggtctttcc
accgaccctttccgacctgccttgctgtgcccgcagccgcagaccttggtgcagtccgtc
ctccaggccgagatggactgtgagctccagagctcgctgcagtggcccttgttcttcccg
gtggatgccagctgcagcggagtgttccggccccggcccgtgtccccaagcagcctgctg
gacacagccatcagtgaggaggccaggcaggggccgggcctagaggaggagcaggacacg
caggagtccctgcccagcagcacgggccggaggcacaccctggccgaggtctccacccgc
ctctccccactcaccgcgccatgtatagtcgtctccccctccaccacggcaagtcctgca
gagggaaccagctctgacagttgtctgaccttctctgcgagcaaaagccccgcggggctc
agtggcaccccggccactcaggggctgctgggcgcctgctccccggtcaggctggcctcg
cccttcctggggtcgcagtccgccaccccagtgctgcaggctcaggggggcttgggagga
gctgttctgctccctgtcagcttccaggagggacggcgggcgtcggacacctcactgact
caagggctgaaggcctttcggcagcagctgaggaagaccacgcggaccaaagggtttctg
ggactgaacaaaatcaaggggctggctcgccaggtgtgccaggtccctgccagccgggcc
agcaggggcggcctgagccccttccacgcccctgcacagagcccaggcctgcacggcggc
gcagccggcagccgggagggctggagcctgctggaggaggtgctagagcagcagaggctg
ctccagttacagcaccacccggccgctgcacccggctgctcccaggccccccagccggcc
cctgccccgtttgtgatcgccccctgtgatggccctggggctgccccgctccccagcacc
ctcctcacgtcggggctcccgctgctgccgcccccactcctgcagaccggcgcgtccccg
gtggcctcagcggcgcagctcctggacacacacctgcacattggcaccggccccaccgcc
ctccccgctgtgcccccaccacgcctggccaggctggccccaggttgtgagcccctgggg
ctgctgcagggggactgtgagatggaggacctgatgccctgctccctaggcacgtttgtc
ctggtgcagtga

KEGG   Homo sapiens (human): 150094
Entry
150094            CDS       T01001                                 

Gene name
SIK1, MSK, SIK, SIK-1, SIK1B, SNF1LK
Definition
(RefSeq) salt inducible kinase 1
  KO
K19008  serine/threonine-protein kinase SIK1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04922  Glucagon signaling pathway
Disease
H00606  Early infantile epileptic encephalopathy
H01819  Early myoclonic encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    150094 (SIK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    150094 (SIK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     150094 (SIK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   150094 (SIK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo
Other DBs
NCBI-GeneID: 150094
NCBI-ProteinID: NP_775490
OMIM: 605705
HGNC: 11142
Ensembl: ENSG00000142178
Vega: OTTHUMG00000086874
Pharos: P57059(Tchem)
UniProt: P57059
LinkDB
Position
21q22.3
AA seq 783 aa
MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTKTQVAIKIIDK
TRLDSSNLEKIYREVQLMKLLNHPHIIKLYQVMETKDMLYIVTEFAKNGEMFDYLTSNGH
LSENEARKKFWQILSAVEYCHDHHIVHRDLKTENLLLDGNMDIKLADFGFGNFYKSGEPL
STWCGSPPYAAPEVFEGKEYEGPQLDIWSLGVVLYVLVCGSLPFDGPNLPTLRQRVLEGR
FRIPFFMSQDCESLIRRMLVVDPARRITIAQIRQHRWMRAEPCLPGPACPAFSAHSYTSN
LGDYDEQALGIMQTLGVDRQRTVESLQNSSYNHFAAIYYLLLERLKEYRNAQCARPGPAR
QPRPRSSDLSGLEVPQEGLSTDPFRPALLCPQPQTLVQSVLQAEMDCELQSSLQWPLFFP
VDASCSGVFRPRPVSPSSLLDTAISEEARQGPGLEEEQDTQESLPSSTGRRHTLAEVSTR
LSPLTAPCIVVSPSTTASPAEGTSSDSCLTFSASKSPAGLSGTPATQGLLGACSPVRLAS
PFLGSQSATPVLQAQGGLGGAVLLPVSFQEGRRASDTSLTQGLKAFRQQLRKTTRTKGFL
GLNKIKGLARQVCQAPASRASRGGLSPFHAPAQSPGLHGGAAGSREGWSLLEEVLEQQRL
LQLQHHPAAAPGCSQAPQPAPAPFVIAPCDGPGAAPLPSTLLTSGLPLLPPPLLQTGASP
VASAAQLLDTHLHIGTGPTALPAVPPPRLARLAPGCEPLGLLQGDCEMEDLMPCSLGTFV
LVQ
NT seq 2352 nt   +upstreamnt  +downstreamnt
atggttatcatgtcggagttcagcgcggaccccgcgggccagggtcagggccagcagaag
cccctccgggtgggtttttacgacatcgagcggaccctgggcaaaggcaacttcgcggtg
gtgaagctggcgcggcatcgagtcaccaaaacgcaggttgcaataaaaataattgataaa
acacgattagattcaagcaatttggagaaaatctatcgtgaggttcagctgatgaagctt
ctgaaccatccacacatcataaagctttaccaggttatggaaacaaaggacatgctttac
atcgtcactgaatttgctaaaaatggagaaatgtttgattatttgacttccaacgggcac
ctgagtgagaacgaggcgcggaagaagttctggcaaatcctgtcggccgtggagtactgt
cacgaccatcacatcgtccaccgggacctcaagaccgagaacctcctgctggatggcaac
atggacatcaagctggcagattttggatttgggaatttctacaagtcaggagagcctctg
tccacgtggtgtgggagccccccgtatgccgccccggaagtctttgaggggaaggagtat
gaaggcccccagctggacatctggagcctgggcgtggtgctgtacgtcctggtctgcggt
tctctccccttcgatgggcctaacctgccgacgctgagacagcgggtgctggagggccgc
ttccgcatccccttcttcatgtctcaagactgtgagagcctgatccgccgcatgctggtg
gtggaccccgccaggcgcatcaccatcgcccagatccggcagcaccggtggatgcgggct
gagccctgcttgccgggacccgcctgccccgccttctccgcacacagctacacctccaac
ctgggcgactacgatgagcaggcgctgggtatcatgcagaccctgggcgtggaccggcag
aggacggtggagtcactgcaaaacagcagctataaccactttgctgccatttattacctc
ctccttgagcggctcaaggagtatcggaatgcccagtgcgcccgccccgggcctgccagg
cagccgcggcctcggagctcggacctcagtggtttggaggtgcctcaggaaggtctttcc
accgaccctttccgacctgccttgctgtgcccgcagccgcagaccttggtgcagtccgtc
ctccaggccgagatggactgtgagctccagagctcgctgcagtggcccttgttcttcccg
gtggatgccagctgcagcggagtgttccggccccggcccgtgtccccaagcagcctgctg
gacacagccatcagtgaggaggccaggcaggggccgggcctagaggaggagcaggacacg
caggagtccctgcccagcagcacgggccggaggcacaccctggccgaggtctccacccgc
ctctccccactcaccgcgccatgtatagtcgtctccccctccaccacggcaagtcctgca
gagggaaccagctctgacagttgtctgaccttctctgcgagcaaaagccccgcggggctc
agtggcaccccggccactcaggggctgctgggcgcctgctccccggtcaggctggcctcg
cccttcctggggtcgcagtccgccaccccagtgctgcaggctcaggggggcttgggagga
gctgttctgctccctgtcagcttccaggagggacggcgggcgtcggacacctcactgact
caagggctgaaggcctttcggcagcagctgaggaagaccacgcggaccaaagggtttctg
ggactgaacaaaatcaaggggctggctcgccaggtgtgccaggcccccgccagccgggcc
agcaggggcggcctgagccccttccacgcccctgcacagagcccaggcctgcacggcggc
gcagccggcagccgggagggctggagcctgctggaggaggtgctagagcagcagaggctg
ctccagttacagcaccacccggccgctgcacccggctgctcccaggccccccagccggcc
cctgccccgtttgtgatcgccccctgtgatggccctggggctgccccgctccccagcacc
ctcctcacgtcggggctcccgctgctgccgcccccactcctgcagaccggcgcgtccccg
gtggcctcagcggcgcagctcctggacacacacctgcacattggcaccggccccaccgcc
ctccccgctgtgcccccaccacgcctggccaggctggccccaggttgtgagcccctgggg
ctgctgcagggggactgtgagatggaggacctgatgccctgctccctaggcacgtttgtc
ctggtgcagtga

DBGET integrated database retrieval system